KEGG   Mus musculus (house mouse): 140493
Entry
140493            CDS       T01002                                 
Symbol
Kcnn3, KCa2.3, SK3, SKCA3
Name
(RefSeq) potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3
  KO
K04944  potassium intermediate/small conductance calcium-activated channel subfamily N member 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04911  Insulin secretion
mmu04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    140493 (Kcnn3)
   04929 GnRH secretion
    140493 (Kcnn3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    140493 (Kcnn3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   140493 (Kcnn3)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 DUF6775 IRK
Other DBs
NCBI-GeneID: 140493
NCBI-ProteinID: NP_536714
MGI: 2153183
Ensembl: ENSMUSG00000000794
UniProt: P58391
Position
3:89427471..89579801
AA seq 732 aa
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQPPPPPAPPAVPQQPPGPLLQPQPPQ
PQQQQSQQQQQQQSQQQQQQAPLHPLPQLAQLQSQLVHPGLLHSSPTAFRAPTSANSTAI
LHPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCK
YSGGVMKPLSRLSASRRNLIEAEPEGQPLQLFSPSNPPEIIISSREDNHAHQTLLHHPNA
THNHQHAGTTAGSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMV
IETELSWGLYSKDSMFSLALKCLISLSTVILLGLIIAYHTREVQLFVIDNGADDWRIAMT
YERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIA
RVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVR
VCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVV
AVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRK
HQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSL
ESKLEHLTASFNSLPLLIADTLRQQQQQLLTAFVEARGISVAVGTSHAPPSDSPIGISST
SFPTPYTSSSSC
NT seq 2199 nt   +upstreamnt  +downstreamnt
atggacacttctgggcacttccatgactcgggggtgggggacctggatgaagaccccaag
tgtccctgtccatcttctggggacgagcaacagcagcagcagcaaccgccaccaccgcca
gcgccaccagcagtcccccagcagcctccgggacccttgctgcagcctcagcctccgcag
cctcagcagcaacagtcgcagcagcagcagcagcagcagtcgcagcagcagcagcagcag
gctccactgcaccccctgcctcagcttgcccaactccagagccagcttgtccatcctggt
ctgttgcactcttctcccacggcgttcagggcccccacttcagccaactctaccgccatc
ctccacccttcctccaggcaaggcagccagctaaatctcaatgaccacttgcttggccac
tctccaagttccacagccacaagtgggcccggtggaggcagccggcaccggcaggccagc
cccctggtgcaccggcgggacagcaatcccttcacggagatagctatgagctcctgcaaa
tacagcggtggggtcatgaagcccctcagccgcctcagcgcctctcggagaaaccttatc
gaggctgagcctgagggccaacccctccagctcttcagtcccagcaaccccccagagatt
atcatctcctccagggaggataaccatgcccaccagactctgctccatcaccccaacgct
acccacaaccaccagcatgccggcaccacggccggcagcaccaccttccccaaagccaac
aagcggaaaaaccaaaacattggctataagctgggacacaggagggccctgtttgaaaag
agaaagcgactgagtgactatgctctgatttttgggatgtttggaattgttgttatggtg
atagagaccgaactgtcttggggtttgtactcaaaggattccatgttttcgttggccctg
aaatgccttatcagtttatccaccgtcatcctgcttggtttgatcatcgcctatcacaca
agggaagtacagctctttgtgatcgacaatggtgcagatgactggcggatagccatgacc
tacgagcgtatcctctacatcagcctggagatgctggtgtgcgccatccaccccatccct
ggagagtacaagttcttctggactgcacgcctggccttctcctataccccatctcgggca
gaggctgacgtggacattattctgtccatccccatgttcctgcgcctgtacctgatcgcc
cgggtcatgctgctccatagcaaactcttcactgatgcctcctcccgaagcatcggggcc
ctcaacaagatcaacttcaacacccgattcgtcatgaagacgctcatgaccatctgccct
ggcacggtgctgctggtgttcagcatctctctgtggatcatcgctgcctggactgtgcga
gtctgtgaaaggtaccatgatcagcaggatgtaactagtaactttctgggtgccatgtgg
ctcatctccatcacgttcctttccattggctatggggacatggtgccccacacatactgt
gggaaaggtgtctgtcttctcaccggcatcatgggtgcaggctgcactgcccttgtggta
gctgtggttgcccgaaagctcgaactcaccaaagcagagaagcatgtgcacaacttcatg
atggacactcagctcaccaaacggatcaagaatgccgccgccaatgtcctccgggaaacg
tggctaatctataaacatacaaagctgctaaagaagattgaccatgccaaagtcaggaaa
caccagaggaagttcctccaagctatccaccaactgcggggtgtcaagatggaacaaagg
aagctgagtgaccaagccaacaccctggtggacctttccaagatgcagaacgtcatgtat
gacttaatcacggagctcaatgaccggagtgaagatctagaaaagcagattggcagcctg
gagtccaagctggagcacctcacagccagtttcaattccctgcccctgctcatcgcagat
accctgcgccagcagcagcagcagctgctcactgccttcgtggaggcccggggcatcagt
gtggccgtgggaactagccacgcccctccctctgacagccctatcgggatcagctccacc
tctttcccaaccccatacacaagttcaagcagttgctaa

DBGET integrated database retrieval system