KEGG   Mus musculus (mouse): 140557
Entry
140557            CDS       T01002                                 

Gene name
Smc1b, SMC-1B, SMC1beta, Smc1l2
Definition
(RefSeq) structural maintenance of chromosomes 1B
  KO
K06636  structural maintenance of chromosome 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    140557 (Smc1b)
   04114 Oocyte meiosis
    140557 (Smc1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    140557 (Smc1b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    140557 (Smc1b)
  Meiosis-specific sister chromatid cohesion proteins
    140557 (Smc1b)
SSDB
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_23 AAA_29 AAA_15 Ca_chan_IQ SbcCD_C ABC_tran
Other DBs
NCBI-GeneID: 140557
NCBI-ProteinID: NP_536718
MGI: 2154049
Ensembl: ENSMUSG00000022432
UniProt: Q920F6 A1L2Z0
Position
15; 15 E2
AA seq 1248 aa
MGHLELLLVENFKSWRGRQVIGPFKRFTCIIGPNGSGKSNVMDALSFVMGEKTTNLRVKN
IQELIHGAHTGKPVSSSASVTIIYIEDSGEEKTFTRIIRGGCSEYHFGDKPVSRSVYVAQ
LENIGIIVKAQNCLVFQGTVESISMKKPKERTQFFEEISTSGEFIGEYEAKKKKLQKAEE
DAQFHFNVKKNVAAERKHAKIEKEEAEHYQNLLEELKINKIQLMLFQLYYNEEKINVLNT
ELEQMDGNLSVVKDTLSHHENIFKAKKKDYGMLTRQLQQTAKELKSVEAILNQKRPQYIK
AKENTSHHLKKLDLSKKLITDNEKQCSKQEDGIRALVAELADLDRAWKSFEKQMEEKILQ
KGRDIELENSQLDRYKLLKEQVRRKVGIMTQQLEKLQWEQKAEKERLAFEKRRHGDTQGN
LKQIKEQIEEHKKRIEKLEEYTKTCMDCLEDKKQQEEALKKEIENTKSRMSEVNEELSLI
RNELQNAGIDNHEGKRQQKRAEVLEHLKRLYPDSVFGRLLDLCHPIHKKYQLAVTKLFGR
YMVAIVVASEKIAKDCIRFLKAERAEPETFLALDYLDIKPINERLREIKGCKMMIDVIKT
QFPQLKKVIQFVCGNGLVCETVEEARHIAFGGPERRKAVALDGTLFLKSGVISGGSSDLK
HKALCWDEKELHNLRDKRSQLVQELKELMKTLRKETDLKQIQTLVQGTNTRLKYSQNELE
MIKKKHLATFYREQSQLQSELLNIDSQCTMLSEGINKQQQKIEEFQDKIDEVEDDIFQDF
CEEIGVENIREFENKHVKQQQENDQKRLEFEKQKTRLNIQLEYSRNQLKKKLNNIDTLKT
TIQKGKEDIDNLKKTEEECLKIVEELMVKQEQIKEVLATQSSNIEKIHIQIEEERKKVLA
VDREVGKLQKEVVIIQGSLEQKLLEKHNLLLDCKVQDIDISLVLGSLEDIIEMELTETES
TQATADIYEKEASIQIDYSPLREDLKALQSDKEVEAHLTLLLQQVASQENTLLKTTAPNL
RAQENLKTVRDKFQESADVFEASRKEARICRQEFEQVKRRRYDAFSQCFEHISVSIDQIY
KKLCRNNSAQAFLSPENPEEPYLDGISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAVH
SFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQSQEQFQMIIISLKEEFYSKADALIGVYP
EHNECMFSHVLTLDLSKYPDTEDQEGSRSHRKPRVPRVSMSPKSPQSR
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggggcaccttgagctgctgctcgtggagaatttcaagtcgtggcgaggccgccaggtc
atcggccctttcaagaggttcacctgcatcattggccccaacggctccggaaaatctaat
gtaatggatgcacttagttttgtaatgggagaaaagacaactaatttaagagtaaaaaac
attcaagaacttattcatggagcacatactggaaaacctgtttcttcttctgcaagtgtg
acaattatatacatagaggacagtggagaagagaaaacattcacaaggattatccgaggg
gggtgctcagaatatcattttggggataaacccgtgagtcgttctgtgtatgtagcccag
ttggaaaacataggcataatagtcaaagcacagaactgtctagtttttcagggaactgta
gagtcaatatccatgaaaaagcccaaagagagaacccagttttttgaagaaatcagtact
tcaggagaatttataggagaatatgaggcaaagaaaaagaaattacaaaaagctgaagaa
gatgcacaatttcattttaatgtgaaaaaaaatgtagctgcagaacggaagcatgcaaaa
atagagaaagaagaggcagaacattaccaaaatctccttgaagaattgaaaataaacaag
atacaactgatgcttttccaactatattataatgaggaaaaaatcaatgttttaaacact
gaattagagcaaatggacgggaatttaagtgttgtaaaagacactctttctcaccatgaa
aacatatttaaagctaagaaaaaggattatggaatgttaactagacaactacagcaaaca
gcaaaagaactgaaatctgttgaagcaattttaaatcagaagaggcctcagtacattaag
gctaaagaaaacacttctcatcatctaaaaaaattagatttgtctaagaaattgataaca
gacaatgaaaaacaatgttctaagcaggaagatggcatacgagccttagtggcagaactg
gctgatttggatagagcatggaaaagttttgaaaagcagatggaagagaaaatcttacaa
aaagggcgagatattgaattggaaaatagccagctggatcgttacaaactgcttaaggag
caagtcagacggaaggttggtataatgacacaacaactggaaaaactgcagtgggaacag
aaggcagaaaaagaaagacttgcatttgaaaagaggaggcatggagacactcagggaaat
ctaaaacagataaaagaacaaatagaagagcataaaaaacgaatagagaagttggaggaa
tatacaaagacgtgcatggattgcttggaagataaaaaacagcaagaagaggccctgaaa
aaagaaattgaaaatacgaaatcaagaatgtctgaagttaatgaagaattgagtcttatt
agaaatgaattgcagaatgctggaattgataaccatgagggaaaacgtcagcagaaaaga
gcagaagttctggaacaccttaaaagactttacccagattctgtgtttggaagactgctt
gatctgtgtcatcctattcataagaagtaccagctggctgtgactaagctttttggccgg
tacatggttgccattgttgtagcctcagaaaagatagcgaaagattgtattcgatttctg
aaggcagaaagagctgaacctgagacattccttgctctagattaccttgatatcaagcca
atcaatgaacgactaagggaaattaaaggctgtaagatgatgatcgatgttataaagacc
cagtttcctcagctgaagaaagtgattcagtttgtttgtggaaatggccttgtctgtgag
actgtggaagaagcaagacatattgcattcggtggacctgaaagacggaaggcagtagca
cttgatggaacactgtttttgaaatctggagtgatttctggagggtcaagtgacttaaag
cacaaagctctgtgctgggatgagaaagagttacacaatctaagagacaaaagaagccaa
ctagtccaagagctaaaggagttaatgaagacactccgcaaggaaacagatctgaagcaa
atacagactttagtacaaggaaccaatacacgactcaaatattcacaaaatgaactagag
atgattaaaaagaagcaccttgctacattttaccgggaacaatctcagctacaaagtgaa
ttactgaatattgattctcaatgtactatgttgagtgaaggaatcaacaaacagcaacaa
aaaattgaagaatttcaagataagatagatgaggtagaagatgacatattccaagacttc
tgtgaagaaattggtgtggaaaatatccgtgaatttgagaataaacatgttaaacagcag
caagaaaatgatcaaaaaagattagagtttgaaaaacaaaaaactcggcttaatattcag
ctcgaatatagtcgaaatcagcttaagaagaaactgaataatatcgacacattaaaaacc
acaatccagaagggcaaagaagatattgataacctaaaaaagaccgaagaagaatgtctg
aaaattgttgaggaactcatggtgaagcaagagcaaattaaggaagtgcttgccacacag
agttccaacattgaaaaaattcacatacaaattgaagaggaacgcaagaaggttttggct
gttgatagggaagttggaaaattacagaaggaagttgtaatcattcagggttctttggaa
cagaaactgctagagaaacataacttgctgctagattgcaaagttcaagacattgacata
agtcttgtgctggggtcattggaggacatcattgaaatggagctaactgaaacagaaagc
acccaggcaacagctgatatctatgagaaagaagcatccatccaaatagactacagccct
ctaagggaggatttaaaggctctacaatcagataaggaggtggaggcccaccttacactc
cttctacagcaagtagcatcccaagaaaacactctactgaagactacagctccaaacttg
cgagcacaggagaacttaaagactgtcagagacaagtttcaagaatctgcagatgttttt
gaggccagcagaaaggaagccagaatatgtaggcaagagtttgaacaggtgaaaagacgg
aggtacgatgctttcagtcaatgttttgaacacatctcagtctcaattgatcaaatctac
aagaagctctgcaggaacaacagtgcccaggcatttcttagcccagagaaccctgaagaa
ccttacttagatggaattagctacaactgtgtggctccaggcaaacggttcatgcccatg
gacaacctgtcagggggagaaaagtgtgtggctgctctggctcttctgtttgctgtacac
agttttcggcctgctccattctttgtattagatgaagtagatgcagccctggacaatact
aacattggcaaagtctcaagttacatcaaagagcagagtcaggaacagtttcagatgata
atcatttccctgaaagaggagttctactccaaagctgatgcactgataggcgtctaccca
gagcacaatgagtgcatgttcagccatgtgttgactctggacctttccaagtatccagac
accgaagaccaagaaggcagcaggagccaccggaagcccagagtaccacgagtatcaatg
tctccaaagtctccccagtctcgttag

DBGET integrated database retrieval system