KEGG   Mus musculus (mouse): 14057
Entry
14057             CDS       T01002                                 

Symbol
Sfxn1, 2810002O05Rik, A930015P12Rik, f
Name
(RefSeq) sideroflexin 1
  KO
K23500  sideroflexin-1/3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    14057 (Sfxn1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14057 (Sfxn1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    14057 (Sfxn1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC56: Sideroflexin
   14057 (Sfxn1)
SSDB
Motif
Pfam: SFXNs BSD
Other DBs
NCBI-GeneID: 14057
NCBI-ProteinID: NP_081600
MGI: 2137677
Ensembl: ENSMUSG00000021474
UniProt: Q99JR1
Position
13 B1; 13 28.4 cM
AA seq 322 aa
MSGEVPPNINIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVP
AGLTENELWRAKYAYDSAFHPDTGEKMTLIGRMSAQVPMNMTITGCMMTFYRTTPAVLFW
QWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKRVSPLIGRFV
PFAAVAAANCINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPG
MAIPPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLED
ELQASIQRTHPEIRRVYFNKGL
NT seq 969 nt   +upstreamnt  +downstreamnt
atgtctggggaagtgccacccaacattaacatcaaggagcctcgatgggaccagagcacg
ttcattggccgagccagtcacttcttcacggttactgatcccagaaatatccttttaacg
aacgaacagctagagaatgcgaggaaagtggtgcatgactacaggcaaggaatcgttcct
gccggcctcacggaaaatgagctatggagagcgaagtacgcgtacgactcggccttccat
cctgacaccggtgaaaagatgactctgataggaagaatgtcagctcaggtcccgatgaac
atgaccatcacaggctgcatgatgaccttctaccggaccacaccggctgtgcttttctgg
cagtggataaaccagtccttcaatgccgtggtcaactacaccaacagaagcggtgacgct
cccctcactgtgaatgagctgggaacggcttatgtttctgcaaccactggcgctgtggca
acggccctaggactcaatgccttaaccaagcgtgtctccccactgataggacgttttgtt
cccttcgctgctgtagctgctgctaactgcattaacatcccactgatgagacaaagggag
ctgaaggttggtattcctgtcactgatgaaaatggcactcgcttgggagaatcgaccaac
gcagcaaagcaagccatcacgcaggtggtcatctccaggatcctcatggcagccccgggc
atggccatccctccgtttatcatgaacaccttggaaaagaaagcctttttaaagaggttc
ccgtggatgagtgcgccaatccaagtcacgttggttggcttttgtttggtattcgccacc
cccctgtgctgtgctctgtttcctcagaagagttccatgtctgtgacaagcttggaggat
gagttgcaagccagcatccaaaggactcatcctgaaatacggcgtgtgtactttaacaag
ggcctgtga

DBGET integrated database retrieval system