KEGG   Mus musculus (mouse): 14058Help
Entry
14058             CDS       T01002                                 

Gene name
F10, Cf10, fX
Definition
(RefSeq) coagulation factor X
  KO
K01314  coagulation factor X [EC:3.4.21.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14058 (F10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    14058 (F10)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14058 (F10)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.6  coagulation factor Xa
     14058 (F10)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   14058 (F10)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis
   14058 (F10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Gla FXa_inhibition EGF hEGF Trypsin_2 cEGF DUF1986 EGF_CA EGF_3 EGF_2
Motif
Other DBs
NCBI-GeneID: 14058
NCBI-ProteinID: NP_031998
MGI: 103107
Ensembl: ENSMUSG00000031444
Vega: OTTMUSG00000020614
UniProt: O88947 Q3TBR2
Position
8 A1.1; 8 5.73 cM
AA seq 481 aa AA seqDB search
MGSPVQLSLLCVVLASLLLPGKGVFINRERANNVLARTRRANSFFEEFKKGNLERECMEE
ICSYEEVREIFEDDEKTKEYWTKYKDGDQCESSPCQNQGACRDGIGGYTCTCSEGFEGKN
CELFVRKLCRLDNGDCDQFCREEQNSVVCSCASGYFLGNDGKSCISTAPFPCGKITTGRR
KRSVALNTSDSELDLEDALLDEDFLSPTENPIELLNLNETQPERSSDDLVRIVGGRECKD
GECPWQALLINEDNEGFCGGTILNEFYILTAAHCLHQARRFKVRVGDRNTEKEEGNEMVH
EVDVVIKHNKFQRDTYDYDIAVLRLKTPITFRMNVAPACLPQKDWAESTLMTQKTGIVSG
FGRTHEKGRQSNILKMLEVPYVDRNTCKLSTSFSITQNMFCAGYEAKLEDACQGDSGGPH
VTRFKNTYYVTGIVSWGEGCARKGKYGIYTKVTTFLKWIDRSMKARVGPTAETPRTAGPP
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggggagcccggtgcaactcagcctgctctgtgttgtcctggccagcctcctgctccct
gggaaaggtgtgtttattaaccgggaacgtgccaacaatgtcctggcgaggactcggagg
gcaaactcattttttgaagagttcaagaaaggaaatctggaaagagagtgtatggaagaa
atttgttcttatgaagaggtccgtgaaatcttcgaggacgacgagaagacgaaagaatac
tggaccaaatataaagacggcgaccagtgtgaaagcagcccttgccagaaccaaggagcg
tgtcgagatggcatcgggggttacacgtgcacctgctcggagggatttgaaggcaaaaac
tgtgagctctttgttcggaaactctgccgcctagacaacggagactgtgaccagttctgc
agagaagagcagaactcagtggtgtgctcctgcgccagcggttacttcctgggtaatgat
ggcaagtcttgcatctccacagctcccttcccctgtggaaaaatcactacaggacgtagg
aagaggtctgtggccctaaacaccagcgacagtgagcttgaccttgaagacgccctgctt
gatgaggatttcctgtcccctacggagaatcctattgaactgctcaacctcaacgagaca
cagcctgagaggagcagcgatgaccttgttcggattgtgggtggccgggaatgcaaggat
ggagaatgtccctggcaggctctgctcattaacgaagacaatgaagggttctgtgggggc
accatcttgaatgagttctacatcctcactgctgcccactgtctccatcaggccaggcga
ttcaaggtgagggtaggtgatcggaacacagagaaggaagaaggcaacgagatggtgcac
gaggtggacgtggtcattaagcacaacaagtttcagagggacacctacgactatgatatc
gccgtgctgaggctgaagactcccatcacgttccggatgaacgtggcccctgcctgcctg
cctcagaaagactgggccgagtccacactgatgacacagaagacgggcatcgtgagcggg
tttggacgcacgcatgagaagggccgccagtcgaacatcctgaagatgctggaggtaccc
tacgtggatcgcaacacctgcaagctctccaccagcttcagcatcacacagaatatgttc
tgtgcgggctatgaggccaagttagaggatgcctgccagggggacagtggtggcccccat
gtcacacggttcaaaaatacctactatgtgaccggcattgtcagctggggagaggggtgt
gcaaggaaagggaaatatggcatctacacaaaggtcacgaccttcctcaagtggattgac
aggtccatgaaagccagggtgggacccacagccgagaccccaaggacagcaggtccgccc
aattaa

DBGET integrated database retrieval system