KEGG   Mus musculus (mouse): 14060
Entry
14060             CDS       T01002                                 

Gene name
F13b, Cf-13b, Cf13b
Definition
(RefSeq) coagulation factor XIII, beta subunit
  KO
K03906  coagulation factor XIII B polypeptide
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14060 (F13b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    14060 (F13b)
SSDB
Motif
Pfam: Sushi Sushi_2 AraC_binding MAR_sialic_bdg
Other DBs
NCBI-GeneID: 14060
NCBI-ProteinID: NP_112441
MGI: 88379
Ensembl: ENSMUSG00000026368
Vega: OTTMUSG00000021467
UniProt: Q07968 Q3UER0
Position
1 F; 1 61.57 cM
AA seq 669 aa
MMTLRHLPFILLLILSGELYAEEKQCDFPTVENGRIAQYYYTFKSFYFPMSVDKKLSFFC
LAGYATESGKQEEQIRCTAEGWSPNPRCYKKCLKPDLRNGYVSNDKVLYKLQERMSYGCS
SGYKTTGGKDEEVVHCLSAGWSSQPSCRKEQETCLAPELEHGNYSTTQRTFKVKDIVAYT
CTAGYYTTTGKQTGEAECQANGWSLTPQCNKLMCSSLRLIENGYFHPVKQTYEEGDVVQF
FCHENYYLSGSDLIQCYNFGWYPESPICEGRRNRCPPPPVPLNSKIQPHSTTYRHGERVH
IECELNFVIQGSEELLCENGKWTEPPKCIEEKEKVACEQPPSVENGVAHPHSEIYYSGDK
VTYRCGGGYSLRGSSTITCNRGRWTLPPECVENIENCKPPPDIANGVVVDGLLASYTTGS
SVEYRCNEYYLLKGSETSRCEQGAWSSPPVCLEPCTIDVDHMNRNNIQLKWKYEGKILHG
DLIDFVCKQGYNLSPSIPLSEISAQCNRGDVRYPMCIRKESKGMCASPPVIRNGDIVSSA
ARTYENGSSVEYRCFDNHFLQGSQNVYCVDGVWTTPPSCLEPCTLSFVEMDKNYLQLKWN
FDNRPLILHGEYIEFMCKRDAYISETSIAGSVLRVQCDRGRLKYPKCTPRDRRLSFQEAL
RTRRQMEKR
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgatgacgctgagacacttgccatttattcttttattaatcctctcaggagaactctat
gcagaagagaaacagtgtgattttcctaccgtggaaaatggaaggattgcccaatattat
tatacgtttaaaagcttttacttccccatgagcgtagacaaaaaactatcattcttctgt
ttggctggctatgcaaccgaaagtgggaagcaagaagagcaaatcaggtgcacagcagaa
ggctggtctccaaacccaaggtgctacaagaaatgtctgaagcctgacctaaggaatggc
tacgtctccaatgacaaagtactgtacaaacttcaagagaggatgagctacggttgctct
tcaggatacaaaaccactgggggaaaggacgaggaggtggtccactgtctttctgcaggg
tggtcttctcaaccgtcctgcaggaaagaacaagagacatgtttggcccctgagttggaa
catggaaattactccacgacgcagagaacattcaaagtgaaggacatagtggcttacaca
tgcactgcaggctactacaccactacagggaagcagactggggaagcagagtgccaggct
aatggctggtccctcacaccacagtgcaacaaattaatgtgctcttctttgagattaata
gaaaatggctattttcatcctgtaaagcaaacatatgaagaaggagatgtagttcaattt
ttctgtcatgaaaattattatctaagtggatctgatttaattcagtgctataactttggc
tggtatccagaatctcccatatgtgaaggaagaagaaatcgatgtcctcctccacctgtg
cctctaaattctaaaattcaaccacattcaacaacttaccgtcacggagaaagagtgcat
atagaatgtgaacttaattttgtgattcagggttcagaagaactgctctgtgaaaatggg
aagtggacagaacctccaaaatgtattgaggaaaaggagaaggtagcctgcgagcaacca
ccctccgttgagaatggtgttgcacacccacactctgagatttactacagtggggataaa
gtgacatacaggtgtggagggggctacagtctcagaggatcaagtacgataacttgcaat
cgtggccgatggacactgccccctgagtgtgttgaaaatattgagaattgtaagcctcct
cctgacatagcaaacggtgtggttgttgatgggttactggcaagttacacaacaggatct
tctgtggagtaccgatgcaatgagtattacttattgaaggggtcggaaacatctcgctgt
gaacaaggagcgtggtcatctccacctgtctgcttggagccctgcactattgatgtggat
cacatgaacaggaataacatacagttgaagtggaaatatgagggcaagattttacatgga
gacctaatagattttgtgtgtaagcagggatataacttgtcaccatcaatcccactgtcg
gagatatctgcgcagtgcaatagaggcgatgtgaggtaccccatgtgcattagaaaagaa
tctaaagggatgtgtgcatctcctccagtgataagaaatggagatattgttagttcagca
gcccgcacctatgaaaacggctcctcagtagaataccggtgttttgataatcatttccta
caagggtcccagaatgtctattgtgtcgatggagtgtggactacaccaccatcgtgtcta
gagccttgcacattatcatttgttgaaatggataagaattatttacagctgaaatggaat
tttgacaacagaccactcattttacatggagagtatattgagtttatgtgtaagagagat
gcatatataagtgagacatctattgctgggtctgtacttcgggtgcagtgtgacagggga
aggctgaaataccctaagtgtactccaagagacaggaggctgtcctttcaggaagcatta
cggacccgaagacaaatggaaaaaagataa

KEGG   Mus musculus (mouse): 74145
Entry
74145             CDS       T01002                                 

Gene name
F13a1, 1200014I03Rik, AI462306, F13a
Definition
(RefSeq) coagulation factor XIII, A1 subunit
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    74145 (F13a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    74145 (F13a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     74145 (F13a1)
SSDB
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Other DBs
NCBI-GeneID: 74145
NCBI-ProteinID: NP_001159863
MGI: 1921395
Ensembl: ENSMUSG00000039109
UniProt: Q8BH61 Q3V3W7
Position
13; 13 A3.3
AA seq 732 aa
MSDTPASTFGGRRAVPPNNSNAAEVDLPTEELQGLVPRGVNLKDYLNVTAVHLFKERWDS
NKIDHHTDKYDNNKLIVRRGQTFYIQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPV
PVVKELQSGKWGAKVIMNEDRSVRLSVQSSPECIVGKFRMYVAVWTPYGILRTRRDPETD
TYILFNPWCEEDAVYLDDEKEREEYVLNDIGVIFYGDFKDIKSRSWSYGQFEDGILDTCL
YVMDKAEMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYAYGIPPSAWTGSVDIL
LEYRSSETPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGN
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLVYITAKQDGTHVVEAVDATHIGKLIVTKQIGGDGMQDITD
TYKFQEGQEEERLALETALMYGAKKTLNTEGVVKSRSDVTMNFDVENAVLGKDFKVTITF
QNNSSNLYTILAYLSGNITFYTGVSKKEFKKESFEETLDPFSSKKKEVLVRAGEYMSHLL
EQGFLHFFVTARINESRDVLAKQKSIILTIPKITIKVRGAAMVGSDMVVTVEFTNPLKET
LQNVWIHLDGPGVMRPKRKVFREIRPNTTVQWEEVCRPWVSGHRKLIASMTSDSLRHVYG
ELDLQIQRRPTM
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtcagatactccagcaagcacctttggggggaggcgagcagtcccgcccaataactcc
aatgctgcagaagtggacctcccaactgaggagctacaaggcctggtgccaaggggtgtc
aacctgaaagattacctgaatgtcacagctgttcacctgttcaaggagagatgggacagt
aacaagattgatcaccacacagacaaatatgacaacaataagttgattgtccgcagaggg
cagaccttctacatccagattgacttcaaccgtccctatgaccccaggaaggatctcttc
agagtggaatatgtcattggtcgctaccctcaggagaacaagggcacctacatccctgtg
cctgtagtgaaagagctgcaaagcggaaagtggggagccaaggttatcatgaatgaggac
cggtcggtgcgactttccgttcagtcttctccggaatgcattgtggggaaattccgcatg
tatgttgcagtctggactccctatggcatcctgcgtactcgaagagacccagaaacagac
acatatattctcttcaacccttggtgtgaagaggacgctgtgtatctggatgatgagaag
gaaagagaagagtacgtcctgaatgacattggagtgatattttatggggacttcaaagac
atcaagagcagaagctggagctatggccagttcgaagacggcatcctggatacttgcttg
tatgtgatggacaaagctgagatggacctttctggcagaggcaaccccatcaaagtcagc
cgagttggatcagcaatggtgaatgccaaggatgatgaaggtgttcttgttggatcatgg
gacaatgtctatgcctacggcatccctccatcagcctggacaggaagtgttgacattcta
ctagaatacagaagctcggaaacaccagtccgatatggccagtgttgggtttttgctggt
gtctttaacacatttttaagatgccttggaatccctgcacgagtcattaccaattacttc
tcggcccacgacaatgatgccaatctgcaaatggacatcttcctggaagaagatgggaat
gtgagctccaaactcaccaaggattcggtgtggaactaccactgctggaacgaagcgtgg
atgacaaggcctgatcttcctgttggatttggaggctggcaagctgtggacagcacaccc
caggaaaacagtgatggcatgtaccgctgtggccctgcctctgtccaagccgttaagcat
ggccatgtctgcttccagtttgatgccccgtttgtttttgcagaggtcaacagtgatctt
gtttacatcacagctaagcaagatggcactcacgtggtggaagccgtggatgccacccat
atcgggaagctaattgtgaccaagcaaattggaggagatggcatgcaggatatcacggat
acttacaaatttcaagaaggccaagaagaagagagactagcccttgaaactgctctgatg
tatggagccaagaagaccctcaacactgaaggtgttgtcaaatcaaggtctgatgtgacc
atgaactttgatgtggaaaatgctgtgctgggaaaggacttcaaagtgactatcaccttc
cagaacaatagctccaatctgtacaccatcctggcctatctttctggcaacatcaccttc
tacactggggtatccaagaaagagttcaagaaggagtcctttgaagagacgctggatccc
ttttcctccaagaaaaaggaggtgctggtcagagcgggcgagtacatgagccaccttcta
gaacagggcttcttgcacttcttcgtcacggcacgcatcaacgagtccagggatgtcctg
gccaaacaaaagtccataatactgactatccccaagatcaccatcaaggtccgaggtgct
gccatggttggctctgatatggttgtgactgttgagttcactaatcctttaaaagaaaca
ctacaaaatgtctggattcatttggatggtcctggagtgatgagacccaagagaaaggtg
ttccgtgaaatccggcccaacaccacggtgcagtgggaagaagtctgtcggccttgggtc
tctggccatcggaagctgattgccagcatgaccagtgactccctgagacatgtgtatgga
gagctggatcttcagattcaaagacgacctactatgtaa

DBGET integrated database retrieval system