KEGG   Mus musculus (house mouse): 14063
Entry
14063             CDS       T01002                                 
Symbol
F2rl1, Gpcr11, PAR-2, Par2
Name
(RefSeq) coagulation factor II (thrombin) receptor-like 1
  KO
K04234  coagulation factor II (thrombin) receptor-like 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14063 (F2rl1)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    14063 (F2rl1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    14063 (F2rl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14063 (F2rl1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Thrombin
    14063 (F2rl1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srw 7TM_GPCR_Sru GPR_Gpa2_C
Other DBs
NCBI-GeneID: 14063
NCBI-ProteinID: NP_032000
MGI: 101910
Ensembl: ENSMUSG00000021678
UniProt: P55086 Q3TU81
Position
13:complement(95648226..95661748)
AA seq 399 aa
MRSLSLAWLLGGITLLAASVSCSRTENLAPGRNNSKGRSLIGRLETQPPITGKGVPVEPG
FSIDEFSASILTGKLTTVFLPVVYIIVFVIGLPSNGMALWIFLFRTKKKHPAVIYMANLA
LADLLSVIWFPLKISYHLHGNNWVYGEALCKVLIGFFYGNMYCSILFMTCLSVQRYWVIV
NPMGHPRKKANIAVGVSLAIWLLIFLVTIPLYVMKQTIYIPALNITTCHDVLPEEVLVGD
MFNYFLSLAIGVFLFPALLTASAYVLMIKTLRSSAMDEHSEKKRQRAIRLIITVLAMYFI
CFAPSNLLLVVHYFLIKTQRQSHVYALYLVALCLSTLNSCIDPFVYYFVSKDFRDHARNA
LLCRSVRTVNRMQISLSSNKFSRKSGSYSSSSTSVKTSY
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgcgaagtctcagcctggcgtggctgctgggaggtatcacccttctggcggcctcggtc
tcctgcagccggaccgagaaccttgcaccgggacgcaacaacagtaaaggaagaagtctt
attggcagattagaaacccagcctccaatcactgggaaaggggttccggtagaaccaggc
ttttccatcgatgagttctctgcgtccatcctcaccgggaagctgaccacggtctttctt
ccggtcgtctacattattgtgtttgtgattggtttgcccagtaatggcatggccctctgg
atcttccttttccgaacgaagaagaaacaccccgccgtgatttacatggccaacctggcc
ttggccgacctcctctctgtcatctggttccccctgaagatctcctaccacctacatggc
aacaactgggtctacggggaggccctgtgcaaggtgctcattggctttttctatggtaac
atgtattgctccatcctcttcatgacctgcctcagcgtgcagaggtactgggtgatcgtg
aaccccatgggacaccccaggaagaaggcaaacatcgccgttggcgtctccttggcaatc
tggctcctgatttttctggtcaccatccctttgtatgtcatgaagcagaccatctacatt
ccagcattgaacatcaccacctgtcacgatgtgctgcctgaggaggtattggtgggggac
atgttcaattacttcctctcactggccattggagtcttcctgttcccggccctccttact
gcatctgcctacgtgctcatgatcaagacgctccgctcttctgctatggatgaacactca
gagaagaaaaggcagagggctatccgactcatcatcaccgtgctggccatgtacttcatc
tgctttgctcctagcaaccttctgctcgtagtgcattatttcctaatcaaaacccagagg
cagagccacgtctacgccctctaccttgtcgccctctgcctgtcgaccctcaacagctgc
atagacccctttgtctattactttgtctcaaaagatttcagggatcacgccagaaacgcg
ctcctctgccgaagtgtccgcactgtgaatcgcatgcaaatctcgctcagctccaacaag
ttctccaggaagtccggctcctactcttcaagctcaaccagtgttaaaacctcctactga

DBGET integrated database retrieval system