KEGG   Mus musculus (mouse): 14067
Entry
14067             CDS       T01002                                 

Gene name
F5, AI173222, Cf-5, Cf5
Definition
(RefSeq) coagulation factor V
  KO
K03902  coagulation factor V (labile factor)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14067 (F5)
SSDB
Motif
Pfam: F5_F8_type_C Cu-oxidase_3 Cu-oxidase_2 LSPR
Other DBs
NCBI-GeneID: 14067
NCBI-ProteinID: NP_032002
MGI: 88382
Ensembl: ENSMUSG00000026579
Vega: OTTMUSG00000034808
UniProt: O88783
Position
1 H2.2; 1 71.46 cM
AA seq 2183 aa
MLLVCPCFFLLVVLGTRWAGWGSHQAEAAQLRQFYVAAQGILWNYHPEPTDPSLNSIPSF
KKIVYREYEQYFKKEKPRSSNSGLLGPTLYAEVGDVIKVHFRNKADKPLSIHPQGIKYSK
FSEGASYADHTFPAERKDDAVAPGEEYTYEWIVSEDSGPTPDDPPCLTHIYYSYENLTQD
FNSGLIGPLLICKKGTLTEDGTQKMFDKQHVLLFAVFDESKSRSQSPSLMYTINGFVNKT
MPDITVCAHDHVSWHLIGMSSGPELFSIHFNGQVLEQNQHKVSTVTLVSATSTTANMTMS
PEGRWIVSSLIPKHYQAGMQAYIDIKNCPKKTRSPKTLTREQRRYMKRWEYFIAAEEVIW
NYAPVIPANMDKIYRSQHLDNFSNQIGKHYKKVIYRQYEEETFTKRTDNPSIKQSGILGP
VIRAQVRDTLKIVFKNMASRPYSIYPHGVTFSPYEDGINSSSTSGSHTTIRPVQPGETFT
YKWNILEFDEPTENDAQCLTRPYYSDVDVTRDIASGLIGLLLICKSRSLDQRGVQRVADI
EQQAVFAVFDENKSWYIEDNINKFCENPDEVKRDDPKFYESNIMSTINGYVPESISTLGF
CFDDTVQWHFCSVGTHDDILTIHFTGHSFIYGRRHEDTLTLFPMRGESVTVTMDNVGTWM
LTTMNSNPKRRNLRLRFRDVKCNRDYDNEDSYEIYEPPAPTSMTTRRIHDSLENEFGIDN
EDDDYQYLLASSLGIRSFKNSSLNPEENEFNLTALALENSSEFISPSTDRVVDSNSSRIL
SKIINNNLKDFQRTLPGSGATVAGTLLRNLIGLDENFVLNSSTEHRSSSYHENDMENPQS
NITMVYLLPLGPKGSGNREQDKPKTIKTGRPHMMKHRFSWMKAPAGKTGRHSNPKNSYSG
MKSEEDIPSELIPLKQKITSKFLNRRWRVASEKGSYEIIAANGEDTDVDKLTNSPQNQNI
TVPRGESTSHTNTTRKPSDLPTFSGVGHKSPHVRQEEENSGFQKRQLFIRTRKKKKNKKL
ALHSPLSPRGFDPLRGHNHSPFPDRRLLNHSLLLHKSNETALSPDLNQTSPSMSTDRSLP
DYNQYSKNDTEQMSSSLDLYQSVPAEEHSPTFPAQDPDQTHSTTDPSYRSSPPELSQGLD
YDLSHDFYPDDIGLTSFFPDQSQKSSFSSDDDQAIPSSDLSLFTISPELDQTIIYPDLDQ
LLLSPEDNQKTSSPDLGQVPLSPDDNQKTSSPDLGQVSLSPDDNQKTSSPDLGQVPLSLD
DNQKTTSPDLGQVPLSPDDNQMITSPDLGQVPLSSDNQKTSSPDLGQVPLFPEDNQNYFL
DLSQVPLSSDQNQETSSTDLLTLSPDFGQTVLSPDLDQLPLPSDNSQVTVSPDLSLLTLS
PDFNEIILAPDLGQVTLSPDLIQTNPALNHGHKASSADPDQASYPPDSGQASSLPELNRT
LPHPDLTHIPPPSPSPTLNNTSLSRKFNPLVVVGLSRVDGDDVEIVPSEEPERIDEDYAE
DDFVTYNDPYRTDTRTDVNSSRNPDTIAAWYLRGHGGHKKFYYIAAEEITWNYAEFAQSE
MDHEDTGHTPKDTTYKKVVFRKYLDSTFTSRDPRAEYEEHLGILGPVIRAEVDDVIQVRF
KNLASRPYSLHAHGLSYEKSSEGKTYEDESPEWFQEDDAVQPNSSYTYVWHATKRSGPEN
PGSACRAWAYYSAVNVERDIHSGLIGPLLICRKGTLHMERNLPMDMREFVLLFMVFDEKK
SWYYEKSKGSRRIESPEEKNAHKFYAINGMIYNLPGLRMYEQEWVRLHLLNMGGSRDIHV
VHFHGQTLLDNRTKQHQLGVWPLLPGSFKTLEMKASKPGWWLLDTEVGENQVAGMQTPFL
IIDKECKMPMGLSTGVISDSQIKASEYLTYWEPRLARLNNAGSYNAWSIEKTALDFPIKP
WIQVDMQKEVVVTGIQTQGAKHYLKSCFTTEFQVAYSSDQTNWQIFRGKSGKSVMYFTGN
SDGSTIKENRLDPPIVARYIRIHPTKSYNRPTLRLELQGCEVNGCSTPLGLEDGRIQDKQ
ITASSFKKSWWGDYWEPSLARLNAQGRVNAWQAKANNNKQWLQVDLLKIKKVTAIVTQGC
KSLSSEMYVKSYSIQYSDQGVAWKPYRQKSSMVDKIFEGNSNTKGHMKNFFNPPIISRFI
RIIPKTWNQSIALRLELFGCDIY
NT seq 6552 nt   +upstreamnt  +downstreamnt
atgctcctagtctgcccgtgcttcttcctcctggtggttctgggaacccgctgggcgggc
tggggcagccaccaggcagaggccgcgcaactaaggcagttctatgtggcagctcagggg
atcctctggaactatcatcctgagcccacagatccaagtttgaattctataccttccttc
aagaaaattgtctacagagagtatgaacagtattttaagaaagaaaagccacgatctagc
aactcaggacttcttggacctactttatacgctgaagttggggacgtcattaaagttcac
tttagaaacaaagcagacaaaccactaagcatccatcctcaagggattaaatacagtaaa
ttttcagaaggggcttcttacgcagaccacacgttccctgccgagaggaaggatgatgcc
gtggctcctggagaagaatacacctatgaatggatcgtcagtgaggacagcgggcccaca
cctgatgacccaccatgcctcacccacatctactattcctatgaaaacctgacccaggat
ttcaactcgggtctgattgggcctctgcttatctgcaagaaaggcaccctgaccgaggat
gggactcagaagatgtttgacaagcagcatgtgctcctatttgctgtgtttgatgaaagc
aagagccggagccagtcaccatccctaatgtacacaattaatggctttgtgaataagacg
atgccagatataacagtctgtgcccatgaccacgtcagctggcatctgatcgggatgagc
tcggggccagaattgttttctattcacttcaacggccaagtcctagagcagaaccagcat
aaagtgtccaccgtcaccctggtcagcgcaacatctacgactgcaaacatgactatgagc
ccagaaggaagatggattgtttcttctctcatcccaaagcattatcaagctgggatgcag
gcttacattgacattaaaaactgcccaaagaaaacgaggagccccaagaccctcactcgg
gagcagaggcggtacatgaagagatgggagtatttcatagccgcagaggaggtcatttgg
aactatgcacccgtgatacctgcgaatatggacaaaatttacaggtctcagcacttggat
aatttctcaaaccaaattggaaaacattacaagaaagttatctacaggcaatatgaagaa
gagaccttcaccaaacgcactgacaaccccagcatcaaacaaagtgggattctgggccct
gttatcagagcccaggtcagagacacactcaagatcgtgttcaaaaatatggcgagccga
ccctacagcatttaccctcacggggtgaccttctctccttacgaagatggaatcaattct
tcctccacctcaggcagtcacaccacgatcagaccagttcaaccgggggaaaccttcact
tacaaatggaacattctagagtttgatgaacccacggaaaacgatgcccagtgcctaaca
aggccatactacagtgatgtggacgttacaagggatattgcctctgggctgatagggctg
cttctaatttgtaagagcaggtccctggaccagaggggtgtacagagggtggcagacatc
gagcagcaggccgtgtttgctgtgtttgacgagaacaagagctggtacattgaggacaac
atcaacaagttctgtgagaatcctgatgaggtgaagcgtgatgatcccaagttttacgaa
tcaaacatcatgagcactatcaacggctacgtgcccgagagcatttccactctgggattc
tgttttgatgacactgtccagtggcacttctgcagtgtgggaactcatgatgatattttg
accatccacttcactgggcactcgttcatctatgggaggaggcacgaggacaccttgacc
ctgttccccatgcgtggtgaatctgtgacagttacaatggataatgttggaacttggatg
ttgaccaccatgaattccaatccaaaacgcagaaacctaagactgagattcagagatgtt
aagtgtaatcgggattatgacaatgaggactcatatgagatttatgaacctcctgcacct
acatccatgacaactcggagaattcatgattccttagaaaatgaatttggcatagacaac
gaagatgatgattaccagtacttactggcgtcatcattaggaattaggtcattcaaaaac
tcatcattgaatccagaggaaaatgagttcaatctcactgctctcgctctggagaacagc
tctgagttcatatctccaagcacagacagagttgttgactcaaactcttcacgaatcctt
agtaaaatcatcaataataacctcaaagactttcaaagaacacttcctggctcaggagcc
accgtggctggtaccctccttagaaacctcattggcttagatgagaacttcgtcctcaac
tcttctacagaacatcgttccagctcatatcatgaaaatgatatggaaaatccacagtca
aacatcacaatggtatacctacttcctcttggtccaaaaggatctgggaatcgagaacaa
gataaacctaaaaccatcaagacaggaagaccccacatgatgaagcacaggttctcctgg
atgaaagcgccagctggtaaaactgggaggcattcaaacccaaagaattcgtattctgga
atgaagtctgaggaggacattcctagcgagttgatacccttaaagcaaaagatcacttcc
aaatttctgaatagacgatggcgtgtggcttctgaaaagggtagttatgaaataatagca
gcaaatggtgaagacacagatgtggataagctgaccaacagtcctcaaaatcagaatatc
acagtacctcggggagagagcacctctcacacaaacacaacaagaaagccaagtgacctc
ccaacattttctggagttggacataaatctccacatgtaagacaggaggaagaaaacagt
ggttttcagaaaagacagttattcatcaggacacggaagaagaagaaaaataagaagctt
gcactacacagtcctctatctccaaggggctttgaccctttgagaggacataaccattcc
ccatttccagacaggagactacttaatcactcactgttactccacaagtccaatgaaaca
gctctttctccagacctgaaccagacctctccttcaatgagtacggacaggtcacttcct
gactataatcagtactcgaaaaatgacactgagcagatgagctcttctttagatctttat
cagtcagtgcccgcagaggaacactctccaacatttcctgcccaagatcctgatcaaaca
cactctaccacagatcctagctacagatcctctccgccagagctcagccaggggcttgat
tatgacctaagtcatgacttttaccctgatgacattggtctaacatctttctttccagac
caaagtcaaaagtcatctttctcttcagatgatgaccaagcaatcccttcctcagactta
agcctctttaccatctctccagaattggatcagacaattatttacccagacctggatcag
ttgctcctttctccagaagacaatcagaagacctcctccccagacctgggccaggtgccc
ctttctccagatgacaaccagaagacctcctccccagacctgggtcaggtgtccctttct
ccagatgataaccagaagacctcctccccagacctgggtcaggtgcccctttctctagat
gacaaccagaagacgacctccccagacctgggtcaggtgcccctttctccagatgacaac
cagatgatcacctccccagacctgggtcaggtgcccctttcttctgataaccagaagacc
tcttccccagatctgggtcaggtgcctctttttcctgaagacaaccagaattacttccta
gacctgagtcaggtacctctctcctcagaccaaaaccaggagacctcctccacagaccta
ctgactctctctcctgattttggtcagacagtcctttccccagacttggatcagctgcca
ctcccttcagacaatagtcaggtgaccgtttccccagacctcagcctcttgaccctctca
ccagattttaatgagataatcctagccccagaccttggtcaagtgaccctctctccagac
ctcatccagacaaaccctgctcttaatcatggacacaaagcatcctctgcagaccctgat
caagcatcctaccctccagattctggtcaggcttcatcgcttccagaactgaatcggact
cttcctcatccagatctcactcacataccacctccttcaccatctcccacactcaataac
acttctttgtcaaggaaatttaaccctcttgttgtagtaggtctcagtagagtagatgga
gacgacgttgagattgttccaagtgaggagccagagagaatagatgaagattatgccgag
gatgactttgtaacctataatgacccctacagaacagacactaggacagatgtcaattcc
tccagaaatcctgacactatcgcagcatggtacctccgaggccacggtggacacaaaaaa
ttctactatattgcagctgaagaaataacctggaattacgcagagtttgcacaaagtgaa
atggaccatgaagacacaggccacactccaaaggacaccacatacaagaaagtcgttttc
agaaaataccttgatagcacgtttacaagtcgtgatcctcgggcagaatatgaggagcac
cttggcattctcggtcctgtgatccgggctgaagtggatgatgtgatccaagttcgattt
aaaaatttggcatccagaccgtattctcttcatgctcacggactttcctatgaaaaatcc
tcagaggggaagacttatgaagatgaatctcctgaatggtttcaggaagatgatgctgtc
cagcccaatagcagttacacctatgtatggcatgccaccaagcgctcagggccagagaac
cctggttctgcctgccgggcttgggcctactattctgcagtgaatgtggagagggacatc
cactcaggcttgatcggcccccttctgatctgccggaaaggaacacttcacatggagcgc
aacctgcctatggacatgagagagtttgtcttactcttcatggtctttgatgagaagaag
agctggtactatgaaaagtccaaggggtcacggagaattgaatccccagaagagaaaaat
gcccacaagttttacgcaattaatgggatgatctacaacctgcccggcctgagaatgtac
gagcaagagtgggtgaggctacacctgctgaacatgggcggctcccgagatattcacgtg
gttcacttccatggccagaccctgctggataataggaccaaacagcaccagttaggcgtc
tggccccttctgcctggttcatttaaaactcttgaaatgaaggcatccaagcctggctgg
tggctcctagacacagaggttggagaaaaccaggtagctggcatgcaaacgccatttctc
atcatagacaaagagtgtaagatgccaatgggactaagcactggtgtcatatctgattca
cagatcaaggcttcggaatatctgacttattgggagcccagattagcacgattaaacaat
gctggttcatacaatgcttggagtatagaaaaaactgcattagattttcccattaaacct
tggatccaggtggacatgcagaaggaagttgtagtcaccgggatacaaacccaaggtgct
aaacactacctaaagtcctgctttaccacggagttccaagtggcttacagctctgaccaa
accaactggcagatcttcagagggaagagcgggaagagcgtgatgtattttactggtaat
tcagatggctctacaataaaagagaatcgacttgacccacccattgtggctagatacatt
aggatacacccaacaaaatcctataatagacccacccttcggctggagctgcagggctgt
gaggtgaacggatgttccacaccactgggcctggaagatggacggattcaagacaagcaa
attactgcatcttcatttaaaaagtcgtggtggggagactactgggagccctcccttgcc
cgcctgaacgcccagggccgcgtgaacgcctggcaagccaaggcaaacaacaacaagcag
tggttacaagtcgatctgctcaaaatcaagaaggtaacggccatcgtaacgcagggctgt
aagtctctgtcctctgagatgtacgtgaagagctacagcatccagtacagtgaccagggt
gtggcatggaaaccttaccgacagaaatcctccatggtggacaagatttttgaaggaaac
agcaataccaaggggcacatgaagaactttttcaacccgcccattatttccagatttatc
cgcatcattcctaaaacatggaaccagagcatcgcccttcgcctagagctcttcggctgt
gacatttattag

DBGET integrated database retrieval system