KEGG   Mus musculus (mouse): 14068
Entry
14068             CDS       T01002                                 

Gene name
F7, AI132620, Cf7, F, FVII
Definition
(RefSeq) coagulation factor VII
  KO
K01320  coagulation factor VII [EC:3.4.21.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14068 (F7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    14068 (F7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.21  coagulation factor VIIa
     14068 (F7)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   14068 (F7)
SSDB
Motif
Pfam: Trypsin Gla DUF1986 FXa_inhibition EGF hEGF Trypsin_2 Imm17
Other DBs
NCBI-GeneID: 14068
NCBI-ProteinID: NP_034302
MGI: 109325
Ensembl: ENSMUSG00000031443
Vega: OTTMUSG00000020609
UniProt: P70375 Q542C2
Structure
PDB: 
5KXH 5KY2 5KY3

Position
8 A1.1; 8 5.73 cM
AA seq 446 aa
MVPQAHGLLLLCFLLQLQGPLGTAVFITQEEAHGVLHRQRRANSLLEELWPGSLERECNE
EQCSFEEAREIFKSPERTKQFWIVYSDGDQCASNPCQNGGTCQDHLKSYVCFCLLDFEGR
NCEKSKNEQLICANENGDCDQYCRDHVGTKRTCSCHEDYTLQPDEVSCKPKVEYPCGRIP
VVEKRNSSSRQGRIVGGNVCPKGECPWQAVLKINGLLLCGAVLLDARWIVTAAHCFDNIR
YWGNITVVMGEHDFSEKDGDEQVRRVTQVIMPDKYIRGKINHDIALLRLHRPVTFTDYVV
PLCLPEKSFSENTLARIRFSRVSGWGQLLDRGATALELMSIEVPRLMTQDCLEHAKHSSN
TPKITENMFCAGYMDGTKDACKGDSGGPHATHYHGTWYLTGVVSWGEGCAAIGHIGVYTR
VSQYIDWLVRHMDSKLQVGVFRLPLL
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggttccacaggcgcatgggctgctgcttctctgctttctgctccagctccagggacct
ctagggactgcagttttcataacccaggaggaagcacatggtgtcctacacaggcaaagg
cgtgccaactcactcctggaggagctttggcccggctctctggagagagagtgcaatgag
gaacagtgctcctttgaggaggcccgggagatcttcaagagccctgagaggaccaagcag
ttctggattgtttacagtgatggggaccagtgtgcctcgaatccatgtcagaacggaggt
acctgccaggatcatctcaagtcttacgtctgcttctgcctcctagactttgagggtcgg
aactgtgagaaaagcaagaatgagcagctgatctgtgcaaatgaaaatggtgactgtgac
cagtactgcagggaccatgtagggaccaagcgtacctgtagctgtcatgaggactacacg
ctacagccagatgaggtgtcctgcaaaccaaaagttgagtacccgtgtgggagaatacct
gttgtagaaaaaagaaactccagcagccgccaaggccgcattgtgggaggcaacgtgtgc
cccaaaggggagtgtccatggcaggctgtgctgaaaatcaatgggttattgctgtgtggg
gccgtcctgctggacgccagatggatagtgaccgcagcccactgcttcgataatatccgc
tactggggaaacatcacagtggtgatgggtgaacatgacttcagtgagaaggatggggat
gagcaagtacgacgggtgacacaggtcatcatgcccgacaagtacatccgcggcaagatc
aaccacgacattgccctgctccgccttcaccggcctgtgaccttcactgactacgtggtg
cccctgtgtctgcctgaaaagtccttctccgagaacaccctagccagaatccgcttctca
agggtcagtggctggggccagctactggaccgtggtgccacagccctggaactcatgtcc
atcgaggtgccccggctgatgacccaggactgtctggagcacgccaagcacagctctaac
acccccaaaatcacagagaacatgttctgcgctggctacatggatggtaccaaggacgcc
tgcaagggtgacagcggtggcccacatgccacgcactaccatggcacatggtatctgaca
ggtgtggtcagctggggggagggctgtgcagctattggtcacattggggtgtacaccagg
gtctcccagtacatagactggctggtcagacacatggactccaagctccaggttggggtt
ttccgactcccactactgtag

DBGET integrated database retrieval system