KEGG   Mus musculus (mouse): 14069
Entry
14069             CDS       T01002                                 

Gene name
F8, Cf-8, Cf8, F, FVIII
Definition
(RefSeq) coagulation factor VIII
  KO
K03899  coagulation factor VIII
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14069 (F8)
SSDB
Motif
Pfam: F5_F8_type_C Cu-oxidase_3 Cu-oxidase_2
Other DBs
NCBI-GeneID: 14069
NCBI-ProteinID: NP_032003
MGI: 88383
Ensembl: ENSMUSG00000031196
Vega: OTTMUSG00000020850
UniProt: Q06194 B2RRC9 Q8BQ43
Position
X A7.3; X 38.17 cM
AA seq 2319 aa
MQIALFACFFLSLFNFCSSAIRRYYLGAVELSWNYIQSDLLSVLHTDSRFLPRMSTSFPF
NTSIMYKKTVFVEYKDQLFNIAKPRPPWMGLLGPTIWTEVHDTVVITLKNMASHPVSLHA
VGVSYWKASEGDEYEDQTSQMEKEDDKVFPGESHTYVWQVLKENGPMASDPPCLTYSYMS
HVDLVKDLNSGLIGALLVCKEGSLSKERTQMLYQFVLLFAVFDEGKSWHSETNDSYTQSM
DSASARDWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEIHSIFLEGHTFFVRN
HRQASLEISPITFLTAQTLLIDLGQFLLFCHISSHKHDGMEAYVKVDSCPEESQWQKKNN
NEEMEDYDDDLYSEMDMFTLDYDSSPFIQIRSVAKKYPKTWIHYISAEEEDWDYAPSVPT
SDNGSYKSQYLSNGPHRIGRKYKKVRFIAYTDETFKTRETIQHESGLLGPLLYGEVGDTL
LIIFKNQASRPYNIYPHGITDVSPLHARRLPRGIKHVKDLPIHPGEIFKYKWTVTVEDGP
TKSDPRCLTRYYSSFINPERDLASGLIGPLLICYKESVDQRGNQMMSDKRNVILFSIFDE
NQSWYITENMQRFLPNAAKTQPQDPGFQASNIMHSINGYVFDSLELTVCLHEVAYWHILS
VGAQTDFLSIFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWVLGCHNSDFRKRG
MTALLKVSSCDKSTSDYYEEIYEDIPTQLVNENNVIDPRSFFQNTNHPNTRKKKFKDSTI
PKNDMEKIEPQFEEIAEMLKVQSVSVSDMLMLLGQSHPTPHGLFLSDGQEAIYEAIHDDH
SPNAIDSNEGPSKVTQLRPESHHSEKIVFTPQPGLQLRSNKSLETTIEVKWKKLGLQVSS
LPSNLMTTTILSDNLKATFEKTDSSGFPDMPVHSSSKLSTTAFGKKAYSLVGSHVPLNVS
EENSDSNILDSTLMYSQESLPRDNILSMENDRLLREKRFHGIALLTKDNTLFKDNVSLMK
TNKTYNHSTTNEKLHTESPTSIENSTTDLQDAILKVNSEIQEVTALIHDGTLLGKNSTYL
RLNHMLNRTTSTKNKDIFHRKDEDPIPQDEENTIMPFSKMLFLSESSNWFKKTNGNNSLN
SEQEHSPKQLVYLMFKKYVKNQSFLSEKNKVTVEQDGFTKNIGLKDMAFPHNMSIFLTTL
SNVHENGRHNQEKNIQEEIEKEALIEEKVVLPQVHEATGSKNFLKDILILGTRQNISLYE
VHVPVLQNITSINNSTNTVQIHMEHFFKRRKDKETNSEGLVNKTREMVKNYPSQKNITTQ
RSKRALGQFRLSTQWLKTINCSTQCIIKQIDHSKEMKKFITKSSLSDSSVIKSTTQTNSS
DSHIVKTSAFPPIDLKRSPFQNKFSHVQASSYIYDFKTKSSRIQESNNFLKETKINNPSL
AILPWNMFIDQGKFTSPGKSNTNSVTYKKRENIIFLKPTLPEESGKIELLPQVSIQEEEI
LPTETSHGSPGHLNLMKEVFLQKIQGPTKWNKAKRHGESIKGKTESSKNTRSKLLNHHAW
DYHYAAQIPKDMWKSKEKSPEIISIKQEDTILSLRPHGNSHSIGANEKQNWPQRETTWVK
QGQTQRTCSQIPPVLKRHQRELSAFQSEQEATDYDDAITIETIEDFDIYSEDIKQGPRSF
QQKTRHYFIAAVERLWDYGMSTSHVLRNRYQSDNVPQFKKVVFQEFTDGSFSQPLYRGEL
NEHLGLLGPYIRAEVEDNIMVTFKNQASRPYSFYSSLISYKEDQRGEEPRRNFVKPNETK
IYFWKVQHHMAPTEDEFDCKAWAYFSDVDLERDMHSGLIGPLLICHANTLNPAHGRQVSV
QEFALLFTIFDETKSWYFTENVKRNCKTPCNFQMEDPTLKENYRFHAINGYVMDTLPGLV
MAQDQRIRWYLLSMGNNENIQSIHFSGHVFTVRKKEEYKMAVYNLYPGVFETLEMIPSRA
GIWRVECLIGEHLQAGMSTLFLVYSKQCQIPLGMASGSIRDFQITASGHYGQWAPNLARL
HYSGSINAWSTKEPFSWIKVDLLAPMIVHGIKTQGARQKFSSLYISQFIIMYSLDGKKWL
SYQGNSTGTLMVFFGNVDSSGIKHNSFNPPIIARYIRLHPTHSSIRSTLRMELMGCDLNS
CSIPLGMESKVISDTQITASSYFTNMFATWSPSQARLHLQGRTNAWRPQVNDPKQWLQVD
LQKTMKVTGIITQGVKSLFTSMFVKEFLISSSQDGHHWTQILYNGKVKVFQGNQDSSTPM
MNSLDPPLLTRYLRIHPQIWEHQIALRLEILGCEAQQQY
NT seq 6960 nt   +upstreamnt  +downstreamnt
atgcaaatagcactcttcgcttgcttctttctgagccttttcaatttctgctctagtgcc
atcagaagatactaccttggtgcagtggaattgtcctggaactatattcagagtgatctg
ctcagtgtgctgcatacagactcaagatttcttcctagaatgtcaacatcttttccattc
aacacctccatcatgtataaaaagactgtgtttgtagagtacaaggaccagcttttcaac
attgccaagcccaggccaccctggatgggtttgctaggtcctaccatttggactgaggtt
catgacacagtggtcattacacttaaaaacatggcttctcatcctgtcagtcttcatgct
gttggtgtgtcctactggaaagcttctgagggagatgaatatgaagatcagacaagccaa
atggagaaggaagatgataaagttttccctggtgaaagtcatacttatgtttggcaagtc
ctgaaagagaatggtccaatggcctctgaccctccatgtctcacttactcatatatgtct
catgtggatctggtgaaagatttgaattcaggcctcattggagctctgctagtatgtaaa
gaaggcagtctctccaaagaaagaacacagatgttgtaccaatttgtactgctttttgct
gtatttgatgaagggaagagctggcactcagaaacaaacgactcttatacacagtctatg
gattctgcatctgctagagactggcctaaaatgcacacagtcaatggctatgtaaacagg
tctcttccaggtctgattggatgccataggaaatcagtctactggcacgtgattggaatg
ggcaccactcctgaaatacactcaatattcctcgaaggtcacacattttttgtgaggaac
caccgtcaagcttcattggagatatcaccaataactttccttactgctcaaacactcttg
atagatcttgggcagttcctactattttgtcatatctcttcccataaacatgatggcatg
gaagcttatgtcaaagtagatagctgccctgaggaatcccaatggcaaaagaaaaataat
aatgaggaaatggaagattatgatgatgatctttattcagaaatggatatgttcacattg
gattatgacagctctccttttatccaaattcgctcggttgctaaaaagtaccctaaaact
tggatacattatatttctgctgaggaggaagactgggactatgcaccttcagttcctacc
tcggataatggaagttataaaagccagtatctgagcaatggtcctcatcggattggtagg
aaatataaaaaagtcagatttatagcatacacagatgaaacctttaagactcgtgaaact
attcagcatgaatcaggactcttgggacctttactttatggagaagttggagacacactg
ttgattatttttaagaatcaagcaagccgaccatataacatttaccctcatggaatcact
gatgtcagtcctctacatgcaaggagattgccaagaggtataaagcacgtgaaggatttg
ccaattcatccaggagagatattcaagtacaagtggacagttacagtagaagatggacca
actaaatcagatccacggtgcctgacccgctattattcaagtttcattaaccctgagaga
gatctagcttcaggactgattggccctcttctcatctgctacaaagaatctgtagatcaa
aggggaaaccagatgatgtcagacaaaagaaatgtcatcctgttttctatatttgatgag
aaccaaagctggtacatcacagagaacatgcaacgcttcctccccaatgcagctaaaaca
cagccccaggaccctgggttccaggcctccaacatcatgcacagcatcaatggctatgtt
tttgatagcttggagttgacagtttgtttgcatgaggtggcatactggcacattctcagt
gttggagcacagacagacttcttatctatcttcttctctggatatactttcaaacacaaa
atggtctatgaagatacacttaccctgttcccattctcaggagaaactgtctttatgtcg
atggaaaacccaggtctatgggtcttggggtgtcataattcagactttcggaagagaggt
atgacagcattgctgaaagtttctagttgtgacaagagcactagtgattattatgaagaa
atatatgaagatattccaacacagttggtgaatgagaacaatgtcattgatcccagaagc
ttcttccagaatacaaatcatcctaatactaggaaaaagaaattcaaagattccacaatt
ccaaaaaatgatatggagaagattgagcctcagtttgaagagatagcagagatgcttaaa
gtacagagtgtctcagttagtgacatgttgatgctcttgggacagagtcatcctactcca
catggcttatttttatcagatggccaagaagccatctatgaggctattcatgatgatcat
tcaccaaatgcaatagacagcaatgaaggcccatctaaagtgacccaactcaggccagaa
tcccatcacagtgagaaaatagtatttactcctcagcccggcctccagttaagatccaat
aaaagtttggagacaactatagaagtaaagtggaagaaacttggtttgcaagtttctagt
ttgccaagtaatctaatgactacaacaattctgtcagacaatttgaaagcaacttttgaa
aagacagattcttcaggatttccagatatgccagttcactctagtagtaaattaagtact
actgcatttggtaagaaagcatattcccttgttgggtctcatgtacctttaaacgtgagt
gaagaaaatagtgattccaacatattggattcaactttaatgtatagtcaagaaagttta
ccaagagataatatattatcaatggagaatgatagattactcagagagaagaggtttcat
ggaattgctttattgaccaaagataatactttattcaaagacaatgtctccttaatgaaa
acaaacaaaacatataatcattcaacaactaatgaaaaactacacactgagagcccaaca
tcaattgagaatagtacaacagacttgcaagatgccatattaaaggtcaatagtgagatt
caagaagtaacagctttgattcatgatggaacacttttaggcaaaaattctacatatttg
agactaaaccatatgctaaatagaactacctcaacaaaaaataaagacatatttcataga
aaagatgaagatcctattccacaagatgaagagaatacaatcatgccattttccaagatg
ttgttcttgtcagaatcttcaaattggtttaaaaagaccaatggaaataattccttgaac
tctgagcaagaacatagtccaaagcaattagtatatttaatgtttaaaaaatatgtaaaa
aatcaaagtttcttgtcagagaaaaataaagtcacagtagaacaggatggatttacaaag
aacataggacttaaagacatggcttttccacataatatgagcatatttcttaccactttg
tctaacgtacatgaaaatggtaggcacaatcaagaaaaaaatattcaggaagagatagag
aaggaagcactaattgaagagaaagtagttttgccccaggtgcacgaagcaactggctct
aagaatttcttgaaagacatattgatactaggcactaggcaaaatataagtttatatgaa
gtacatgtaccagtacttcaaaacatcacatcaataaacaattcaacaaatacagtacag
attcacatggagcatttctttaaaagaaggaaggacaaggaaacaaattcagaaggcttg
gtaaataaaaccagagaaatggtaaaaaactatccaagccagaagaatattactactcaa
cgtagtaaacgggctttgggacaattcagactgtcaactcaatggcttaaaaccataaac
tgttcaacacagtgtatcattaaacagatagaccacagcaaggaaatgaaaaagttcatt
actaaatcttccttatcagattcttctgtgattaaaagcaccactcagacaaatagttct
gactcacacattgtaaaaacatcagcatttccaccaatagatctcaaaaggagtccattc
caaaacaaattttctcatgttcaagcatcatcctacatttatgactttaagacaaaaagt
tcaagaattcaagaaagcaataatttcttaaaagaaaccaaaataaataacccttcttta
gccattctaccatggaatatgttcatagatcaaggaaaatttacctccccagggaaaagt
aacacaaactcagtcacatataagaaacgtgagaacattattttcttgaaaccaactttg
cctgaagaatctggcaaaattgaattgcttcctcaagtttccattcaagaggaagaaatt
ttacctacagaaactagccatggatctcctggacacttgaatctcatgaaagaggtcttt
cttcagaaaatacaggggcctactaaatggaataaagcaaagaggcatggagaaagtata
aaaggtaaaacagagagctctaaaaatactcgctcaaaactgctaaatcatcatgcttgg
gattatcattatgctgcacagataccaaaagatatgtggaaatccaaagagaagtcacca
gaaattatatccattaagcaagaggacaccattttgtctctgaggcctcatggaaacagt
cattcaataggggcaaatgagaaacaaaattggcctcaaagagaaaccacttgggtaaag
caaggccaaactcaaaggacatgctctcaaatcccaccagtgttgaaacgacatcaaagg
gaacttagtgcttttcaatcagaacaagaagcaactgactatgatgatgccatcaccatt
gaaacaatcgaggattttgacatttacagtgaggacataaagcaaggtccccgcagcttt
caacagaaaacaaggcactattttattgcagctgtggaacgactctgggactatgggatg
agtacatctcatgttctacgaaataggtatcaaagtgacaatgtacctcagttcaagaaa
gtagttttccaggaatttactgatggctcctttagtcagcccttatatcgtggagaatta
aatgaacacctggggttgttgggcccatatataagagcagaagttgaagacaacattatg
gtaactttcaaaaaccaggcctcccgtccctactccttctattctagcctcatttcttat
aaagaagatcagagaggagaagaacctagaagaaactttgtcaagcctaatgaaaccaaa
atttatttttggaaagtacaacatcatatggcacccacagaagatgagtttgactgcaag
gcctgggcttatttctctgatgttgatcttgaaagagatatgcactcgggattaattgga
ccccttctgatttgccacgcgaacacactgaatcctgctcatgggagacaagtgtcagta
caggaatttgctctgcttttcactatctttgatgagaccaagagctggtacttcactgaa
aacgtgaaaaggaactgcaagacaccctgcaatttccagatggaagaccccactttgaaa
gagaattatcgcttccatgcaatcaatggttatgtaatggataccctaccaggcttagta
atggctcaagatcaaaggattcgatggtatcttctcagcatgggcaacaatgagaacatc
caatctattcatttcagtggacatgttttcactgtacggaaaaaagaggagtataaaatg
gcagtgtacaacctctacccaggtgtttttgagactctggaaatgataccatccagagct
ggaatatggcgagtagaatgccttattggcgagcacttacaggctgggatgagcactctt
tttctggtgtacagcaagcagtgtcagattcctcttggaatggcttctggaagcatccgt
gatttccagattacagcttcaggacattatggacagtgggccccaaacctggcaagactt
cattattccggatcaatcaatgcctggagtaccaaggagcccttttcttggatcaaggta
gatctgttggcaccaatgattgttcatggcatcaagactcagggtgctcgtcagaaattt
tccagcctttatatctctcaatttatcatcatgtatagcctggatgggaagaagtggctg
agttatcaaggaaattccactggaaccttaatggttttctttggcaatgtggactcatct
gggattaagcataatagttttaatcctccaattattgctcgatatatccgtttgcacccc
actcattctagcatccgtagtactcttcgcatggagttgatgggctgtgatttaaacagt
tgcagcataccattgggaatggaaagtaaagtaatatcagatacacaaatcactgcctca
tcctacttcaccaacatgtttgctacttggtctccttcacaagctcgacttcacctccag
ggaaggactaatgcctggcgacctcaggtgaatgatccaaaacaatggttgcaagtggac
ttacaaaagacaatgaaagtcactggaataataacccagggagtgaaatctctctttacc
agcatgtttgtgaaagagttccttatttccagcagtcaagatggccatcactggactcaa
attttatacaatggcaaggtaaaggtttttcaggggaatcaggactcatccacacctatg
atgaattctctagacccaccattactcactcgctatcttcgaattcacccccagatctgg
gagcaccaaattgctctgaggcttgagattctaggatgtgaggcccagcagcaatactga

DBGET integrated database retrieval system