KEGG   Mus musculus (mouse): 140709
Entry
140709            CDS       T01002                                 

Gene name
Col26a1, 9430032K24Rik, BC002218, Col26a, Emid, Emid2, Emu2
Definition
(RefSeq) collagen, type XXVI, alpha 1
  KO
K24358  collagen type XXVI alpha (EMI domain-containing protein 2)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    140709 (Col26a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    140709 (Col26a1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 C1q domain-containing proteins
  Emilin / mutimerin group proteins
   140709 (Col26a1)
SSDB
Motif
Pfam: EMI Collagen
Other DBs
NCBI-GeneID: 140709
NCBI-ProteinID: NP_077794
MGI: 2155345
Ensembl: ENSMUSG00000004415
Vega: OTTMUSG00000022688
UniProt: Q91VF6
Position
5; 5 G2
AA seq 440 aa
MKLVLLLPWACCCLCGSALATGFLYPFPAAALQQHGYPEQGAGSPGNGYSSRRHWCHHTV
TRTVSCQVQNGSETVVQRVYQSCRWPGPCANLVSYRTLIRPTYRVSYRTVTALEWRCCPG
FTGSNCEEECMNCTRLSDMSERLTTLEAKVLLLEAAEQPSGPDNDLPPPQSTPPTWNEDF
LPDAIPIAHPGPRRRRPTGPAGPPGQMGPPGPAGPPGSKGEQGQTGEKGPVGPPGLLGPP
GPRGLPGEMGRPGPPGPPGPAGSPGLLPNTPQGVLYSLQTPTDKENGDSQLNPAVVDTVL
TGIPGPRGPPGPPGPPGPHGPPGPPGAPGSQGLVDERVVARPSGEPSVKEEEDKASAAEG
EGVQQLREALKILAERVLILEHMIGVHDPLASPEGGSGQDAALRANLKMKRGGPRPDGIL
AALLGPDPAQKSADQAGDRK
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgaagctggttttgctgttaccatgggcgtgctgctgcttgtgcgggtcggcgctggcc
accggctttctctacccgttcccggcagcagccttgcagcagcacggctacccggagcag
ggcgccggctcccccggcaacggctactcgagtcgccggcactggtgccatcacacggtg
acaaggacagtgtcctgccaggtgcagaatggctccgagacggtggtccagcgagtctac
cagagctgccggtggcctgggccctgtgccaacctcgtgagttacaggactctcattaga
ccgacctaccgggtttcctaccgcacggtgactgcgctggagtggaggtgttgcccagga
ttcaccggaagcaactgcgaggaagaatgtatgaactgtacccggcttagcgacatgagt
gaacggctgaccacgctggaggccaaggtcctcttgctggaagcagctgagcagccttca
ggtccagacaatgacctgccacccccgcagagcaccccaccaacctggaacgaggacttc
ctgccagacgccattcccatcgcacatccagggccccggaggagaagacccacaggtcca
gctggacctccaggacagatgggaccacctggacctgcaggacctccaggttccaaaggt
gaacagggccagacaggagagaagggcccagtgggacctccaggtctcttgggaccaccg
gggccacgcgggctccctggagagatggggcgccctggtccaccaggccctcctggccca
gcaggaagtcctggcctcttgccaaacactccccaaggcgtcctgtattccctgcagaca
ccaacagacaaggagaatggagactcccagctgaaccctgctgttgtagacacagtgctg
actggcatcccaggtccccggggtcccccaggcccccctggtcccccaggaccacacggc
cccccaggacccccaggagcacctggatcccagggcctggtggatgagcgggttgtggca
aggccatctggtgagcccagtgtgaaggaagaagaggacaaagccagcgctgcagaggga
gaaggtgtgcagcagcttcgcgaggccctgaagatcctggcagagagggtccttatcctt
gagcatatgattggagtccatgatcccctggcctctcctgagggtggctctgggcaggat
gcagccctgagagccaatctcaagatgaagcgaggaggtcctcgacctgacggcatcctg
gctgccctgctgggccccgaccctgcacaaaagagcgcagaccaggctggcgacaggaag
taa

DBGET integrated database retrieval system