KEGG   Mus musculus (mouse): 14071Help
Entry
14071             CDS       T01002                                 

Gene name
F9, AW111646, Cf-9, Cf9
Definition
(RefSeq) coagulation factor IX
  KO
K01321  coagulation factor IX (Christmas factor) [EC:3.4.21.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14071 (F9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    14071 (F9)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.22  coagulation factor IXa
     14071 (F9)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   14071 (F9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Gla FXa_inhibition EGF cEGF Trypsin_2 DUF1986 hEGF
Motif
Other DBs
NCBI-GeneID: 14071
NCBI-ProteinID: NP_032005
MGI: 88384
Ensembl: ENSMUSG00000031138
Vega: OTTMUSG00000018393
UniProt: P16294
Position
X A6; X 33.5 cM
AA seq 471 aa AA seqDB search
MKHLNTVMAESPALITIFLLGYLLSTECAVFLDRENATKILTRPKRYNSGKLEEFVRGNL
ERECIEERCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGICKDDISSYECWCQ
VGFEGRNCELDATCNIKNGRCKQFCKNSPDNKVICSCTEGYQLAEDQKSCEPTVPFPCGR
ASISYSSKKITRAETVFSNMDYENSTEAVFIQDDITDGAILNNVTESSESLNDFTRVVGG
ENAKPGQIPWQVILNGEIEAFCGGAIINEKWIVTAAHCLKPGDKIEVVAGEYNIDKKEDT
EQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPICVANREYTNIFLKFGS
GYVSGWGKVFNKGRQASILQYLRVPLVDRATCLRSTTFTIYNNMFCAGYREGGKDSCEGD
SGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacctgaacaccgtcatggcagaatccccggctctcatcaccatcttcctttta
ggatatctactcagtaccgaatgtgcagttttccttgatcgtgaaaatgccaccaaaatt
cttacccgtccaaagagatataattcaggaaaactagaagagtttgttcgaggaaacctt
gaaagagagtgtatagaagaaagatgtagttttgaagaagcacgagaagtttttgaaaac
actgaaaaaactactgaattttggaagcagtatgttgatggagatcagtgtgaatcaaat
ccttgtttaaatggtggaatatgcaaggatgatattagttcctatgaatgctggtgccaa
gttggatttgaaggaaggaactgtgaattagatgcaacgtgtaacattaaaaatggcagg
tgcaagcagttttgtaaaaacagtcctgataacaaggtaatttgttcctgcactgaggga
taccaacttgcagaagaccagaagtcctgtgaaccaacagttccatttccatgtgggaga
gcttctatttcatacagttctaaaaagatcacgagagctgagactgttttctctaatatg
gactatgaaaattctactgaagctgtattcattcaagatgacatcactgatggtgccatt
cttaataacgtcactgaaagtagtgaatcacttaatgacttcactcgagttgttggtgga
gaaaacgcaaaaccgggtcaaatcccttggcaggtcattttaaatggtgaaattgaggca
ttctgtggaggtgccatcattaatgaaaaatggattgtaactgctgcccactgtcttaaa
cctggtgataaaattgaggttgttgctggtgaatataacattgataagaaggaagacaca
gaacaaaggagaaatgtgattcgaactatccctcatcaccagtacaatgcaactattaat
aagtatagtcatgacattgccttgctggaactggataaacctttaatactaaacagctat
gtaacacctatctgtgttgccaatagggaatatacaaatatcttcctcaagtttggttct
ggctatgtcagtggctggggaaaagtcttcaacaaagggagacaggcttccattcttcag
taccttagagttccactggtggatagagccacatgccttaggtccacaacattcactatc
tataacaacatgttctgtgcaggctaccgtgaaggaggcaaagattcgtgtgaaggagat
agtgggggaccccatgttactgaagtagaagggacaagtttcttaactggcattattagc
tggggtgaagaatgtgcaatgaaaggcaaatatggaatatatactaaggtttcccggtac
gtcaactggattaaggaaaaaacaaagctaacttaa

DBGET integrated database retrieval system