KEGG   Mus musculus (mouse): 140740
Entry
140740            CDS       T01002                                 

Gene name
Sec63, 5730478J10Rik, AI649014, AW319215
Definition
(RefSeq) SEC63-like (S. cerevisiae)
  KO
K09540  translocation protein SEC63
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03060  Protein export
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    140740 (Sec63)
   04141 Protein processing in endoplasmic reticulum
    140740 (Sec63)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    140740 (Sec63)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    140740 (Sec63)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   140740 (Sec63)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   140740 (Sec63)
SSDB
Motif
Pfam: Sec63 DnaJ
Other DBs
NCBI-GeneID: 140740
NCBI-ProteinID: NP_694695
MGI: 2155302
Ensembl: ENSMUSG00000019802
Vega: OTTMUSG00000019467
UniProt: Q8VHE0
Position
10 B2; 10 22.89 cM
AA seq 760 aa
MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQIRLKNIRKVYGRCMWYR
LRLLKPQPNIIPTVKKIVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGATVAEI
KKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALP
AWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRN
MDMKRLIMVLAGASEFDPQYNKDSTSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLK
ARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIIMARSREEREFRAPTL
ASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDR
HSLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMA
EVFEKEQSICAAEEQPTEDGQSDANKIKAKGGWQQKNKGPKKMPKSKKKKPLKKKPTTVP
LPQAKQQKQKQANGVVGSEAAIKEEEDDISDKGSDSEEEETNRDSQSEKEDGSDRESDRE
QDEKQSKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIADRKE
QTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAK
PVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEGGD
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggcgggccagcagttccagtacgatgacagcgggaacaccttcttctacttcctcacc
tccttcgtggggctcatcgtgatccccgccacctactacctctggccgcgagaccagaac
gcggagcaaattcgattaaagaatatcagaaaagtatatggaagatgtatgtggtatcgt
ttacggttattaaaaccccagccaaatattattcctacagtaaagaaaatagttctgctt
gcaggatgggcactgttcttatttcttgcatacaaagtttccaaaacagaccgagaatat
caagagtacaatccttatgaagtactaaatttggatcctggagcaacagtggcagaaatt
aagaaacagtatcgcttgttgtcacttaaatatcatccagataaaggaggtgatgaagtc
atgttcatgaggatagcaaaagcatatgcagctttaacagatgaagagtctcggaaaaat
tgggaagaatttggaaatccagatgggcctcaagctacaagctttggaattgctttgcca
gcttggatagttgaccagaaaaattcaattctggttttacttgtgtatggattggctttt
atggttattcttcctgttgtggtgggctcttggtggtatcggtcaatacgatatagtgga
gaccagattctaatacgtacaacacagatttatacatactttgtttataaaactcgaaat
atggatatgaaacgtctcatcatggttttagctggagcttctgaatttgaccctcagtat
aataaagattccacaagcaggccaacagataatattttaataccacagctaatcagggaa
attggcagcataaatttaaagaagaatgaacctccactcacctgtccatacagcctgaag
gccagagttcttttactgtctcatcttgctagaatgaaaattcctgagacactggaagaa
gatcaacagttcatgctgaaaaaatgtcctgctctgcttcaagaaatggttaatgtaatc
tgccagctaataataatggcccggagccgtgaagaaagggagtttcgtgctccaactttg
gcatccttagaaaactgtatgaagctttcccagatggctgttcaggggctccagcagttt
aagtctccccttctgcagctccctcatattgaagaggacaatcttaggagagtttcgaat
cataaaaagtacaaaattaaaactatccaggatttggttagtttaaaagaatcagatcgt
catagtctgctacacttccttgaagatgaaaagtatgaagaggtcatggcggtccttggg
agtttcccgtatgtgaccatggacataaaatcacaggtcttggatgatgaagatagcaac
aacatcacagtaggatccctagttacagtgttggttaagttgacgaggcagaccatggct
gaagtgtttgaaaaggagcagtccatctgcgccgctgaggagcagcccacagaagacggg
cagagtgatgccaacaagatcaaggcaaaaggaggatggcagcagaagaacaaaggaccc
aagaaaatgcccaaatccaaaaaaaagaagcctttaaaaaagaaacccacaactgtaccc
ttacctcaggcaaagcagcagaagcaaaagcaagcaaatggagttgttgggagtgaagct
gcaataaaggaggaagaagacgacatttctgacaagggcagtgattctgaagaggaagaa
accaatagagattctcagagtgagaaagaagatggtagtgacagggagtctgatagagag
caagatgagaaacaaagcaaagatgatgaagcagagtggcaagagttacaacagagtata
cagaggaaagagagagctcttctggagaccaagtcaaagataacacaccctgtctatagt
ctctactttcctgaggaaaaacaagagtggtggtggctttatattgcagataggaaagaa
caaacattaatatccatgccatatcatgtgtgcacactgaaggatacagaagaggtagaa
ctgaagtttcccgcacccggcaagcctggaaattatcagtatacagtgttcctgagatca
gactcctatatgggcttggatcagattaaaccactgaagttggaagttcatgaggccaag
cctgtgccagaaaaccacccacagtgggacacagcgatagaaggtgacgaagaccaggaa
gacagtgaaggatttgaagacagctttgaggaagaggaggaggaagaggaaggtggagac
taa

KEGG   Mus musculus (mouse): 69276
Entry
69276             CDS       T01002                                 

Gene name
Sec62, 3100002M17Rik, AI844545, AW545092, Dtr, Dtrp1, HTP, HTP1, SEC6, Tlo, Tloc1
Definition
(RefSeq) SEC62 homolog (S. cerevisiae)
  KO
K12275  translocation protein SEC62
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03060  Protein export
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    69276 (Sec62)
   04141 Protein processing in endoplasmic reticulum
    69276 (Sec62)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    69276 (Sec62)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   69276 (Sec62)
SSDB
Motif
Pfam: Sec62 YhhN DEP
Other DBs
NCBI-GeneID: 69276
NCBI-ProteinID: NP_081292
MGI: 1916526
Ensembl: ENSMUSG00000027706
Vega: OTTMUSG00000051809
UniProt: Q8BU14
Position
3; 3 A3
AA seq 398 aa
MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVECLLDSK
WAKAKKGEDALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDVKKEKDKGKSESGKE
DDKKSKKESVKEEKTKKEKEKKKDGEKEDSKKEETPGTPKKKETKKKFKLEPHDDQVFLD
GNEVFVWIYDPVHIKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL
LAIARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSE
TKKQQKSDSEEKSDSEKKEDEEGKGAPADHGPEGSGGERHSDTDSDRREDDRSQHSSGNG
NDFEMITKEELEQQTDGDCDEEDDDKDGEVPKSAHEKS
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcggaacgcaggcgacacaagaagcggatccaggaagttggtgaaccatctaaagaa
gagaaggctgtagccaaatatcttcgattcaactgtccaacaaaatccaccaacatgatg
ggtcatcgggttgactattttattgcttcaaaagcagtggagtgcctcttggattcaaag
tgggccaaggccaagaaaggagaggacgctttatttacaaccagggagtctgtggtcgac
tactgcaacaggcttttaaagaaacagtttttccatcgggccctaaaagtaatgaaaatg
aaatatgataaagacgtaaaaaaagaaaaagataaagggaaatcagaaagtgggaaagaa
gatgataaaaagagcaagaaagaaagtgttaaagaagaaaaaacaaaaaaggaaaaagaa
aaaaagaaagatggtgaaaaggaagattccaaaaaggaggaaactccaggaactccaaaa
aagaaggaaactaagaaaaaattcaaacttgagccacatgatgatcaagtttttctggat
ggaaatgaggtttttgtgtggatctatgacccagttcacattaaaacatttgtcatggga
ttaattcttgtgattgcagtaatagcagccaccctcttccctctctggccagcagaaatg
agagtaggtgtttattacctcagtgtgggcgcaggctgttttgtagccagcattcttctc
cttgctattgctcgctgcatcctgtttctcatcatctggctgataactggaggaaggcac
cacttttggttcctgccaaacctgactgctgacgtgggcttcattgactccttcaggccc
ctgtacacacatgagtacaaaggaccaaaagcagacttaaagaaggatgagaaatctgaa
accaaaaagcagcagaagtccgacagtgaggaaaagtcagacagtgagaaaaaggaggat
gaggaagggaaaggagctccggcagaccatggaccagaaggctcgggcggagagcggcac
tcagacacggacagtgacaggcgggaagacgaccgctcgcaacacagtagcgggaacggg
aatgattttgaaatgatcacgaaggaggagctggagcagcagacagatggggattgtgat
gaggaggatgacgacaaagatggagaggtgcctaaatctgcacatgagaaatcataa

DBGET integrated database retrieval system