KEGG   Mus musculus (mouse): 140743
Entry
140743            CDS       T01002                                 

Gene name
Rem2, AW411893
Definition
(RefSeq) rad and gem related GTP binding protein 2
  KO
K07848  Rad and Gem related GTP binding protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    140743 (Rem2)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Ras Family
   Rad/Gem/Kir [OT]
    140743 (Rem2)
SSDB
Motif
Pfam: Ras Roc RsgA_GTPase AAA_5 Septin Arf ABC_tran FeoB_N AAA_16 AAA_22 AAA_29 MMR_HSR1 AAA_24 G-alpha Sigma54_activat
Other DBs
NCBI-GeneID: 140743
NCBI-ProteinID: NP_542764
MGI: 2155260
Ensembl: ENSMUSG00000022176
Vega: OTTMUSG00000035271
UniProt: Q8VEL9 E9Q4D5
Structure
PDB: 
3Q85

Position
14; 14 C2
AA seq 341 aa
MHTDLDTDMDMDTETVALCSSSSRQASPLGTPTPEADTTLLKQKPEKLLAELDLSGPPPA
PGVPRRRGSMPVPYKHQLRRAQAVDELDWPPQASPSGSSDSLGSGEAALTQKDGVFKVML
VGESGVGKSTLAGTFGGLQGDHAHEMENSEDTYERRIMVDKEEVTLIVYDIWEQGDAGGW
LQDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREV
SLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRRGRGHAGGQRPEPSSPDGP
APPTRRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgcacacggaccttgacaccgacatggacatggacacagaaaccgtagcactttgttct
tccagcagccgccaggcctccccactggggacacccacaccagaagcagatactacactt
ctgaaacagaagccagagaaactgttagcagagttggacctgagcgggcctcctcctgct
cctggggtccccagacgaagaggaagcatgcccgtgccctacaaacaccagctgcggcgg
gcccaagctgtagatgaacttgactggccaccccaggcctccccctctggctcctctgac
tccttgggctcaggggaggcagcccttacccaaaaagatggcgtctttaaggtcatgctc
gtgggggagagtggcgtgggcaagagcactctagcgggcacttttggaggtctccaggga
gaccatgctcacgagatggagaactcagaggacacctatgagagacggatcatggtggac
aaagaagaagtgactttaattgtttatgacatctgggaacagggagatgcaggaggatgg
ctgcaggatcactgccttcagacgggggatgcctttctcatcgtcttctcagtgacagat
cgacgaagcttctctaaagttccagaaacccttcttcggctccgggctgggaggccccac
catgacctacctgtcatccttgttggaaataagagtgacctggcccgctcccgggaggta
tcactggaggagggtcgccatctggctgggacgctgagctgcaagcacatcgagacgtcg
gccgctctccaccacaacactcgtgagctcttcgagggtgctgtgcgtcagatcaggctg
cggcggggccggggtcatgccgggggccagcgacccgaacctagcagcccggacggcccc
gcgccgcctacgcgccgtgagagcctcaccaagaaagctaagcgcttcctcgccaacctg
gtgccgcgcaacgctaagttcttcaagcaacgctccaggtcatgtcacgacctctctgtg
ctctga

DBGET integrated database retrieval system