KEGG   Mus musculus (house mouse): 14077
Entry
14077             CDS       T01002                                 
Symbol
Fabp3, Fabph-1, Fabph-4, Fabph1, Fabph4, H-FABP, Mdgi
Name
(RefSeq) fatty acid binding protein 3, muscle and heart
  KO
K08752  fatty acid-binding protein 3, muscle and heart
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    14077 (Fabp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14077 (Fabp3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   14077 (Fabp3)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7 VraX
Other DBs
NCBI-GeneID: 14077
NCBI-ProteinID: NP_034304
MGI: 95476
Ensembl: ENSMUSG00000028773
UniProt: P11404 Q5EBJ0
Position
4:130202531..130209256
AA seq 133 aa
MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKN
TEINFQLGIEFDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTH
GSVVSTRTYEKEA
NT seq 402 nt   +upstreamnt  +downstreamnt
atggcggacgcctttgtcggtacctggaagctagtggacagcaagaattttgatgactac
atgaagtcactcggtgtgggctttgccaccaggcaggtggctagcatgaccaagcctact
accatcatcgagaagaacggggatactatcaccataaagacacaaagtaccttcaagaac
acagagatcaactttcagctgggaatagagttcgacgaggtgacagcagatgaccggaag
gtcaagtcactggtgacgctggacggaggcaaactcatccatgtgcagaagtggaacggg
caggagacaacactaactagggagctagttgacgggaaactcatcctgactctcactcat
ggcagtgtggtgagcactcggacttatgagaaggaggcgtga

DBGET integrated database retrieval system