KEGG   Mus musculus (mouse): 140780
Entry
140780            CDS       T01002                                 

Gene name
Bmp2k, 4933417M22Rik, AA673486, AV128808, BIKE
Definition
(RefSeq) BMP2 inducible kinase
  KO
K08854  BMP2 inducible kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    140780 (Bmp2k)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    140780 (Bmp2k)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     140780 (Bmp2k)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  NAK family [OT]
   140780 (Bmp2k)
SSDB
Motif
Pfam: BMP2K_C Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 140780
NCBI-ProteinID: NP_542439
MGI: 2155456
Ensembl: ENSMUSG00000034663
Vega: OTTMUSG00000021531
UniProt: Q91Z96
Position
5; 5 E3
AA seq 1138 aa
MKKFSRMPKSEGSGGGAAAGGAAGGGLGGGFASSSMGVRVFAVGRYQVTLEESLAEGGFS
TVFLVRTHSGIRCALKRMYVNNTPDLNICKREITIMKELSGHKNIVGYLDCAVNSISDNV
WEVLILMEYCRAGQVVNQMNKKLQTGFTESEVLQIFCDTCEAVARLHQCKTPIIHRDLKV
ENILLNDAGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPI
TTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPDNSRYSHNVHCLIRFMLEPDPE
CRPDIFQVSYFAFKFAKKDCPVSNINNSFLPSTLPEPMTATEAAARKSQMKARITDTIGP
TETSIAPRQRPKANSTAATSSVLTIQSSATPVKVPAPGEFSNHKPKGALRPGNGSEVLMV
QGPPQQPPQQHRVLQQLQQGDWRLQQLHLHRHPHHHHQQQQQQQQQQQQQQLQQQQQQQQ
QLLQNAYLQQYQHAMHQQHILQQQFLMHSVYQPQPPASQYPAMMQQYQQAFLQQQMLARH
QQPAQQVSPEYLTSPQEFSPALVSYASSLPAQVGTIVDSSYGANRSVAEKEAVANFTNQK
TISHPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRSNRLGASTPSDKTVDLPPAPHSRP
PEEPFASVPFISHSGSPEKKTTEHSPNQKSITANLTKNGGSSPLCKDQRAGKKTSENPVI
RGQVQKGHDDSESDFESDPPSPKSSEEEQEDEDAQGEHGDFNDDDTEPENLGHRPLLMDS
EDEEEDDKHSSDSECEQAKTKRGDTSSLRRDKPGVAPDTALLTPARSPADALTPSQEFDV
FGAVPFFAAPAPQSLQHRGDGKNLSQHAFPEQEDFDVFTKAPFNKKVSVQDWPAVGPDAR
PLPARPRSVDIFGSTPFQPFSVSASKSESKEDVFGLVPFEEITGSQQQQKVKQRSLQKLS
SRQRRTKQDVSKSNGKRHHGTPTSAKKTLKPPYRTPERARRHKKVGRRDSQSSNEFLTIS
DSKENISVALTDGKDRASVLPSDESLLDPFGAKPFHPPDLWHQPHQGLSDICVDHTTILP
GRPRQNSVHGSFHSAETLRMDDFGAVPFTELVVQSVTPQQSQPVELDPFGAAPFPSKQ
NT seq 3417 nt   +upstreamnt  +downstreamnt
atgaagaagttctctcggatgcccaagtcggagggcagcggcggcggggcggcggctggc
ggggccgcgggcggcgggctcggcggcggcttcgcaagctcgtccatgggggtccgggtg
ttcgccgtcggccgctaccaggtcaccctggaggagtcgctggccgaaggtggattctcc
actgttttcctggtgcggactcacagtgggatccgatgtgcactgaagcgaatgtatgtc
aataacacacccgacctcaacatttgtaaaagggaaatcacgattatgaaagagttatct
ggccacaaaaatattgtcggttatttggactgtgctgtcaattcaattagtgacaatgtg
tgggaagtgcttatcttaatggaatattgtcgagctgggcaggttgtgaaccagatgaat
aagaagctgcagacaggctttaccgagtcagaagtcctacaaatcttctgtgatacctgc
gaagctgtcgcacgattgcatcaatgtaagactcccataatccaccgggatctgaaggta
gaaaatattttgctaaatgatgctggaaattatgtgctttgtgactttggcagtgccact
aataaatttctcaatcctcaaaaagatggagttaatgtagtagaagaagaaattaaaaaa
tacacgactctgtcgtatagagcaccagaaatgatcaacctttatggagggaaaccgatc
accaccaaggctgatatctgggccttgggatgtttactgtataaactttgtttcttcact
cttccttttggtgagagtcaggttgctatctgtgatggcagcttcaccatcccagacaat
tctcgctactcccacaacgtgcattgcttgattaggttcatgcttgaaccagaccccgag
tgcagacctgacatatttcaagtatcctactttgcgtttaaattcgccaaaaaggattgt
ccggtctccaacatcaataattcttttcttccatcaactcttcccgagccgatgactgct
actgaagctgctgctaggaaaagccagatgaaagccagaataacagataccattggacca
acagaaacctcaattgcaccaagacaaagaccaaaggccaattccactgctgccacttcc
agtgtgctgaccattcagagttcagcaacgcctgtcaaagtccctgctcctggggagttc
agcaaccacaaacccaaaggagcattgagacctggaaatgggtctgaagtcttaatggtt
cagggaccccctcagcaacccccacagcagcatagagtcctccagcagttgcagcaggga
gactggagattacagcaacttcatttgcatcgtcatccccaccaccaccatcagcaacag
caacaacagcaacaacaacagcagcaacaacagctgcagcaacaacagcaacagcaacag
caactacttcaaaatgcttacttgcagcagtatcagcatgcaatgcaccagcagcatata
cttcagcaacagtttctaatgcactcagtgtatcagccacaaccgcctgcatcccagtat
cctgccatgatgcagcagtatcagcaggctttcttgcagcagcagatgctagctcgccat
cagcagccagcacagcaggtatcacccgagtatcttacctccccgcaagagttctcacca
gccttagtttcctacgcctcgtcacttccagctcaggttggaaccatagtggactcttct
tacggtgccaacaggtcagttgctgagaaagaggcagttgcaaattttacaaatcagaag
accattagtcaccctcctgacatgtcaggctggaatccttttggagaagacaatttttcc
aagttaacagaagaggaactgttggacagagaatttgaccttctaagatcaaacaggctc
ggggcgagcacaccctcagataagactgtagacctgccccccgctccacatagccgtcct
ccggaggagccttttgcttccgtccctttcatttctcactcaggttctcctgaaaagaaa
acgacggaacattctccaaatcaaaaatctatcactgcaaaccttaccaaaaatggaggc
tcaagtccactatgtaaagatcagcgagccggaaagaaaacctccgagaatcccgtaatt
aggggtcaagtacaaaagggacatgatgattctgaaagtgatttcgaatcagacccccct
tctcctaagagcagtgaagaagaacaagaggatgaagacgcacagggagaacacggggac
tttaatgatgacgacactgagccggagaacctgggtcacaggcctctgctgatggactct
gaagatgaggaagaggacgacaaacacagctctgattcagagtgtgaacaggcaaagacc
aagagaggagacacgagctccctgcgcagggacaaacctggcgtggccccagacacagcc
ctcctgaccccggcccgctcgcctgctgatgcgctgactcccagtcaggagttcgatgtg
tttggcgctgttcccttctttgcagcgcctgctccgcagagcctgcagcacagaggggat
gggaagaacctgtcccagcatgcttttccagagcaggaggacttcgacgtgttcacaaag
gcacccttcaacaagaaggtcagcgtacaggactggcccgcggtggggccagatgcccgg
cctctgcctgcacggcccagaagtgtagatatatttggctccactcccttccagcccttc
tccgtgtcagccagtaaaagtgaaagcaaggaggatgtttttgggctcgtgccctttgag
gaaataactgggagtcagcagcagcagaaagtcaagcagcgcagcttgcagaaactctcc
tctcgccagagacgcacaaagcaggatgtgtccaaaagcaatgggaagcgccatcacggc
acccctaccagcgcaaagaagacgctgaagcccccctaccgcacgcccgagagggcccgc
agacacaagaaggtgggccgcagagactcccagagcagcaatgagtttttaaccatttcc
gattccaaggagaacatcagcgtcgcgctgactgatggcaaagacagggccagtgtcctg
ccatctgacgagagtctgctggacccattcggtgccaagccctttcatcctccagacttg
tggcaccagccccatcagggcctaagcgacatctgcgttgatcacaccaccattttgcct
gggaggccgcgacagaattcagtacacgggtccttccacagcgcagagacattgagaatg
gatgactttggtgccgtgccctttacagaactcgtggtgcaaagtgtcactccacaacag
tcccaaccggtcgaactagacccctttggtgctgctccatttccttctaaacagtag

DBGET integrated database retrieval system