KEGG   Mus musculus (mouse): 140795Help
Entry
140795            CDS       T01002                                 

Gene name
P2ry14, A330108O13Rik, Gpr105, P2Y14
Definition
(RefSeq) purinergic receptor P2Y, G-protein coupled, 14
  KO
K04299  P2Y purinoceptor 14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    140795 (P2ry14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    140795 (P2ry14)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    140795 (P2ry14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 140795
NCBI-ProteinID: NP_001008497
MGI: 2155705
Ensembl: ENSMUSG00000036381
Vega: OTTMUSG00000052404
UniProt: Q9ESG6 Q544F4
Position
3 D; 3 28.96 cM
AA seq 338 aa AA seqDB search
MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYL
KNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRY
YKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELG
RKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVL
VFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQ
PFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactccaccaccacagaccctccaaaccagccctgctcctggaacaccctgatc
acaaagcagatcattcccgtgttgtacggtatggtcttcatcacggggctcctcctcaat
gggatatcaggatggatattcttttatgtgcccagctccaagagttttatcatctatctc
aagaacatagtggtggctgactttctcatgggcctgactttccctttcaaagtccttggt
gactcaggcctcggcccctggcaggtgaatgtgtttgtgtgcagggtctctgccgtcatc
ttctatgttaatatgtacgtcagcatcgtgttctttgggctcatcagctttgacaggtac
tataaaattgtgaagccccttctgacgtctattgtgcagtcggtgaactatagcaagctg
ctttctgtgctcgtgtggatgctcatgcttctccttgctgtcccaaacatcatcctgaca
aaccagggtgtcaaggaggtcacgaagatacagtgcatggagctcaaaaacgagctgggg
cggaagtggcacaaggcgtctaactatatcttcgtgagtatcttctgggtcgtgtttctt
ctgctaatcgtcttctacacggccatcacgaggaagatcttcaagtctcacctcaagtcc
aggaagaattccacctccgtcaagaggaagtccagccgcaatatcttcagcatcgtgctc
gtttttgtcgtctgctttgtgccttaccacattgccagaatcccctacacaaagagtcag
acggaaggtcactacagctgccggacgaaggagaccctgctctatgcgaaagaattcact
ctgctactctcggctgccaatgtgtgtctggaccccattatttatttcttcttatgccag
ccatttagagaagtcttaaataagaagttacacatgtcactcaaagtccagaatgaccta
gaggtttccaaaaccaaaagggaaaatgcgattcatgaaagcacagatactttgtaa

DBGET integrated database retrieval system