KEGG   Mus musculus (mouse): 14081Help
Entry
14081             CDS       T01002                                 

Gene name
Acsl1, Acas, Acas1, Acs, FACS, Facl2, LACS_1, LACS1
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00071  Fatty acid degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
mmu04216  Ferroptosis
mmu04714  Thermogenesis
mmu04920  Adipocytokine signaling pathway
Module
mmu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    14081 (Acsl1)
   00071 Fatty acid degradation
    14081 (Acsl1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    14081 (Acsl1)
  09143 Cell growth and death
   04216 Ferroptosis
    14081 (Acsl1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    14081 (Acsl1)
   03320 PPAR signaling pathway
    14081 (Acsl1)
  09159 Environmental adaptation
   04714 Thermogenesis
    14081 (Acsl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    14081 (Acsl1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14081 (Acsl1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     14081 (Acsl1)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   14081 (Acsl1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   14081 (Acsl1)
  Exosomal proteins of breast cancer cells
   14081 (Acsl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 14081
NCBI-ProteinID: NP_001289092
MGI: 102797
Ensembl: ENSMUSG00000018796
Vega: OTTMUSG00000022668
UniProt: P41216
Position
8; 8 B1.1
AA seq 699 aa AA seqDB search
MEVHELFRYFRMPELIDIRQYVRTLPTNTLMGFGAFAALTTFWYATRPKALKPPCDLSMQ
SVEIAGTTDGIRRSAVLEDDKLLVYYYDDVRTMYDGFQRGIQVSNNGPCLGSRKPNQPYE
WISYKEVAELAECIGSGLIQKGFKPCSEQFIGLFSQNRPEWVIVEQGCFSYSMVVVPLYD
TLGADAITYIVNKAELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDLVERGK
KCGVEIISLKALEDLGRVNRVKPKPPEPEDLAIICFTSGTTGNPKGAMITHQNIINDCSG
FIKATESAFIASTDDVLISFLPLAHMFETVVECVMLCHGAKIGFFQGDIRLLMDDLKVLQ
PTIFPVVPRLLNRMFDRIFGQANTSLKRWLLDFASKRKEAELRSGIVRNNSLWDKLIFHK
IQSSLGGKVRLMITGAAPVSATVLTFLRTALGCQFYEGYGQTECTAGCCLSLPGDWTAGH
VGAPMPCNYVKLVDVEEMNYLASKGEGEVCVKGANVFKGYLKDPARTAEALDKDGWLHTG
DIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYLRSEAVAQVFVHGESLQAFLIA
VVVPDVESLPSWAQKRGLQGSFEELCRNKDINKAILDDLLKLGKEAGLKPFEQVKGIAVH
PELFSIDNGLLTPTLKAKRPELRNYFRSQIDELYATIKI
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggaagtccatgaattgttccggtattttcgaatgccagagctgattgacattcggcag
tacgtgcgcacccttccaaccaacaccctcatggggtttggggcttttgcagcgctcacc
accttctggtatgccaccaggcctaaggccctgaagccaccatgtgacctctccatgcag
tcagtggaaatagcgggtaccactgatggtattcgaagatcagcagtccttgaagatgac
aagctcttggtgtactactacgacgatgtcagaaccatgtacgatggcttccagaggggg
attcaggtgtcaaataatggtccttgtttaggttctcggaagccaaaccagccctatgag
tggatttcctacaaagaggtggcagaactggctgagtgcataggctccgggctgatccag
aaggggttcaagccttgctccgagcagttcatcggcctcttctctcaaaacagacccgag
tgggtgatcgtcgagcaaggatgcttctcttactcaatggtggtcgtcccgctctatgac
acccttggagctgacgccatcacctacatagtgaacaaagctgaactctctgtgattttt
gctgacaagccagaaaaagccaaactcttattagaaggtgtagaaaacaagttaacacca
tgccttaaaatcatagtcatcatggactcctacggcagtgatctggtggaacgaggcaag
aagtgtggggtggaaatcatcagcctcaaagctctggaggaccttggaagagtgaacaga
gtgaagcccaagcctccagaacccgaagatcttgcgataatttgtttcacaagtggaact
acaggcaaccccaaaggagcaatgatcactcaccaaaacattataaacgactgctcaggt
tttataaaagcaacagagagtgcattcatcgcttccacagatgatgtgctgatatctttc
ttgcctctcgcccatatgtttgagaccgttgtagagtgtgtaatgctgtgtcatggagct
aagataggatttttccaaggagatatcaggctgcttatggacgacctcaaggtgcttcag
cccaccatcttccctgtggttcccaggctgctgaaccggatgttcgacagaatttttgga
caagcaaacacttccttgaagcgatggctgttggactttgcctccaaaaggaaagaggcg
gagcttcgcagtggcatcgtcagaaacaacagcctgtgggataaactcatcttccacaag
atacagtcgagcctgggtgggaaagtccggctgatgatcacaggagcagccccggtgtct
gccacagtgctgacgtttctgaggacagcgctcggctgccagttctatgaaggctacgga
cagaccgagtgcactgctggttgctgcctgagcttgcccggagactggacggcaggccat
gttggagcccccatgccttgcaattatgtaaagcttgtggatgtggaagaaatgaattac
ctggcatccaagggcgagggtgaggtgtgtgtgaaaggggcaaatgtgttcaaaggctac
ttgaaagacccagcaagaacagctgaagccctggataaagatggctggttacacacgggg
gacattggaaaatggctgccaaatggcaccttgaagattatcgacaggaaaaagcacata
tttaaactagcccaaggagagtacatagcaccagaaaagattgaaaatatctacctgcgg
agtgaagccgtggcccaggtgtttgtccacggagaaagcttgcaggcctttctcatagca
gttgtggtacccgacgttgagagcctaccgtcctgggcacagaagagaggcttacaaggg
tccttcgaagaactgtgcaggaacaaggatatcaataaagctatcctggacgacttgttg
aaacttgggaaggaagccggtctgaagccatttgaacaggtcaaaggcattgctgtgcac
ccggaattattttctattgacaacggccttctgactccaacactgaaggcgaagaggcca
gagctacggaactatttcaggtcgcagatagatgaactgtacgccaccatcaagatctaa

DBGET integrated database retrieval system