KEGG   Mus musculus (mouse): 14081
Entry
14081             CDS       T01002                                 

Gene name
Acsl1, Ac, Acas, Acas1, Acs, FACS, Fac, Facl2, LACS_1, LACS1
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00071  Fatty acid degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
mmu04216  Ferroptosis
mmu04714  Thermogenesis
mmu04920  Adipocytokine signaling pathway
Module
mmu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    14081 (Acsl1)
   00071 Fatty acid degradation
    14081 (Acsl1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    14081 (Acsl1)
  09143 Cell growth and death
   04216 Ferroptosis
    14081 (Acsl1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    14081 (Acsl1)
   03320 PPAR signaling pathway
    14081 (Acsl1)
  09159 Environmental adaptation
   04714 Thermogenesis
    14081 (Acsl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    14081 (Acsl1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14081 (Acsl1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     14081 (Acsl1)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   14081 (Acsl1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   14081 (Acsl1)
  Exosomal proteins of breast cancer cells
   14081 (Acsl1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 14081
NCBI-ProteinID: NP_001289092
MGI: 102797
Ensembl: ENSMUSG00000018796
Vega: OTTMUSG00000022668
UniProt: P41216
Position
8; 8 B1.1
AA seq 699 aa
MEVHELFRYFRMPELIDIRQYVRTLPTNTLMGFGAFAALTTFWYATRPKALKPPCDLSMQ
SVEIAGTTDGIRRSAVLEDDKLLVYYYDDVRTMYDGFQRGIQVSNNGPCLGSRKPNQPYE
WISYKEVAELAECIGSGLIQKGFKPCSEQFIGLFSQNRPEWVIVEQGCFSYSMVVVPLYD
TLGADAITYIVNKAELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDLVERGK
KCGVEIISLKALEDLGRVNRVKPKPPEPEDLAIICFTSGTTGNPKGAMITHQNIINDCSG
FIKATESAFIASTDDVLISFLPLAHMFETVVECVMLCHGAKIGFFQGDIRLLMDDLKVLQ
PTIFPVVPRLLNRMFDRIFGQANTSLKRWLLDFASKRKEAELRSGIVRNNSLWDKLIFHK
IQSSLGGKVRLMITGAAPVSATVLTFLRTALGCQFYEGYGQTECTAGCCLSLPGDWTAGH
VGAPMPCNYVKLVDVEEMNYLASKGEGEVCVKGANVFKGYLKDPARTAEALDKDGWLHTG
DIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYLRSEAVAQVFVHGESLQAFLIA
VVVPDVESLPSWAQKRGLQGSFEELCRNKDINKAILDDLLKLGKEAGLKPFEQVKGIAVH
PELFSIDNGLLTPTLKAKRPELRNYFRSQIDELYATIKI
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggaagtccatgaattgttccggtattttcgaatgccagagctgattgacattcggcag
tacgtgcgcacccttccaaccaacaccctcatggggtttggggcttttgcagcgctcacc
accttctggtatgccaccaggcctaaggccctgaagccaccatgtgacctctccatgcag
tcagtggaaatagcgggtaccactgatggtattcgaagatcagcagtccttgaagatgac
aagctcttggtgtactactacgacgatgtcagaaccatgtacgatggcttccagaggggg
attcaggtgtcaaataatggtccttgtttaggttctcggaagccaaaccagccctatgag
tggatttcctacaaagaggtggcagaactggctgagtgcataggctccgggctgatccag
aaggggttcaagccttgctccgagcagttcatcggcctcttctctcaaaacagacccgag
tgggtgatcgtcgagcaaggatgcttctcttactcaatggtggtcgtcccgctctatgac
acccttggagctgacgccatcacctacatagtgaacaaagctgaactctctgtgattttt
gctgacaagccagaaaaagccaaactcttattagaaggtgtagaaaacaagttaacacca
tgccttaaaatcatagtcatcatggactcctacggcagtgatctggtggaacgaggcaag
aagtgtggggtggaaatcatcagcctcaaagctctggaggaccttggaagagtgaacaga
gtgaagcccaagcctccagaacccgaagatcttgcgataatttgtttcacaagtggaact
acaggcaaccccaaaggagcaatgatcactcaccaaaacattataaacgactgctcaggt
tttataaaagcaacagagagtgcattcatcgcttccacagatgatgtgctgatatctttc
ttgcctctcgcccatatgtttgagaccgttgtagagtgtgtaatgctgtgtcatggagct
aagataggatttttccaaggagatatcaggctgcttatggacgacctcaaggtgcttcag
cccaccatcttccctgtggttcccaggctgctgaaccggatgttcgacagaatttttgga
caagcaaacacttccttgaagcgatggctgttggactttgcctccaaaaggaaagaggcg
gagcttcgcagtggcatcgtcagaaacaacagcctgtgggataaactcatcttccacaag
atacagtcgagcctgggtgggaaagtccggctgatgatcacaggagcagccccggtgtct
gccacagtgctgacgtttctgaggacagcgctcggctgccagttctatgaaggctacgga
cagaccgagtgcactgctggttgctgcctgagcttgcccggagactggacggcaggccat
gttggagcccccatgccttgcaattatgtaaagcttgtggatgtggaagaaatgaattac
ctggcatccaagggcgagggtgaggtgtgtgtgaaaggggcaaatgtgttcaaaggctac
ttgaaagacccagcaagaacagctgaagccctggataaagatggctggttacacacgggg
gacattggaaaatggctgccaaatggcaccttgaagattatcgacaggaaaaagcacata
tttaaactagcccaaggagagtacatagcaccagaaaagattgaaaatatctacctgcgg
agtgaagccgtggcccaggtgtttgtccacggagaaagcttgcaggcctttctcatagca
gttgtggtacccgacgttgagagcctaccgtcctgggcacagaagagaggcttacaaggg
tccttcgaagaactgtgcaggaacaaggatatcaataaagctatcctggacgacttgttg
aaacttgggaaggaagccggtctgaagccatttgaacaggtcaaaggcattgctgtgcac
ccggaattattttctattgacaacggccttctgactccaacactgaaggcgaagaggcca
gagctacggaactatttcaggtcgcagatagatgaactgtacgccaccatcaagatctaa

KEGG   Mus musculus (mouse): 216739
Entry
216739            CDS       T01002                                 

Gene name
Acsl6, A330035H04Rik, AW050338, Fac, Facl6, L, LACS, Lacsl, mKIAA0837
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 6
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00071  Fatty acid degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
mmu04216  Ferroptosis
mmu04714  Thermogenesis
mmu04920  Adipocytokine signaling pathway
Module
mmu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    216739 (Acsl6)
   00071 Fatty acid degradation
    216739 (Acsl6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    216739 (Acsl6)
  09143 Cell growth and death
   04216 Ferroptosis
    216739 (Acsl6)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    216739 (Acsl6)
   03320 PPAR signaling pathway
    216739 (Acsl6)
  09159 Environmental adaptation
   04714 Thermogenesis
    216739 (Acsl6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    216739 (Acsl6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    216739 (Acsl6)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     216739 (Acsl6)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   216739 (Acsl6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   216739 (Acsl6)
  Exosomal proteins of breast cancer cells
   216739 (Acsl6)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 216739
NCBI-ProteinID: NP_001028770
MGI: 894291
Ensembl: ENSMUSG00000020333
Vega: OTTMUSG00000005668
UniProt: Q91WC3 Q5ICG4
Position
11 B1.3; 11 32.13 cM
AA seq 697 aa
MQTQEILRILRLPELSDLGQFFRSLSATTLVSVGALAAVLAYWLTHRPKALQPPCNLLKQ
SEEVEDGGGARRSVIGGCTQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFRKPEQPYQW
LSYQEVAKRAEFLGSGLLQHDCKVGTEQFVGVFAQNRPEWIIAELACYTYSMVVVPLYDT
LGPGSISYIINTADICTVIVDKPHKATLLLEHVERKETPGLKLVILMEPFEDALRERGKK
CGVDIKSMQAIEDCGRENHHAPVPPRPDDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGF
LKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVYCHGGRVGFFQGDIRLLSDDMKALRP
TIFPVVPRLLNRMYDKIFHQADTSLKRWLLEFAAKRKQAEVRSGIIRNNSIWDELFFNKI
QASLGGHVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHV
GAPLPCNHIKLVDAEELNYWTCKGEGEICVKGPNVFKGYLKDEDRTKEALDSDGWLHTGD
IGKWLPEGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSEPVAQIYVHGDSLKAFLVGI
VVPDPEVMPSWAQKKGIEGTYQELCMKKELKKAILDDMVMLGKESGLHSFEQVKAIYIHC
DMFSVQNGLLTPTLKAKRPELREYFKKQIEELYLVSV
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgcagacccaggagatcctgaggatcctgcggctgcccgagctatcggacttgggccag
tttttccgcagcctctcagctaccaccctcgtgagtgtgggtgcactggctgccgtcctt
gcctactggctcactcaccggccaaaggccttgcaaccaccatgcaacctcctgaagcag
tcggaagaagtggaggacggtggtggagcccggcgatctgtgattgggggttgcactcaa
ttgcttacccattactatgacgatgcccggaccatgtaccaggtgttccgccgtgggctt
agcatctcagggaatggaccctgtcttggcttccggaagccagagcaaccttaccagtgg
ctgtcctaccaagaggtggccaaaagggctgaatttctggggtcggggcttctccagcac
gactgtaaagtgggcacagagcagttcgttggtgtttttgcacaaaatcggccggagtgg
atcattgccgagctggcctgctacacgtattccatggtggtggtaccgctctacgacacc
ctgggcccagggtctatcagctacatcatcaatactgcggacatttgcacggtaatcgtc
gataaaccccacaaggcaacacttctgctggaacacgtggagaggaaggagactccgggc
ctcaagctggtcatcctcatggagccgtttgaggacgccctgagagagagaggaaagaag
tgcggggtggacatcaagtccatgcaggctatagaggactgtggccgagagaatcatcat
gcccccgtgcccccacggcctgatgacctctccatcgtgtgtttcacaagtggtacaaca
gggaaccccaaaggtgcaatgctcacccacgggaacgtggtggccgatttctcgggcttt
ctgaaagtgacagagaaagtgatctttccgagacaggacgatgtgctcatctccttcctg
cctctggctcacatgtttgagagagtgatccagtctgttgtctactgccacggagggcgc
gtgggcttcttccagggagacatccgcctcctctcagatgacatgaaggctctccgccct
accatcttccctgtggtcccacggctgctgaatcggatgtatgacaagatcttccaccag
gcagacacctcactaaagcgctggctcctggagtttgcagcaaagcgcaagcaggcagag
gtccggagcggaatcatcagaaacaatagtatctgggatgaactcttctttaataagatt
caggccagtcttggtgggcatgtgaggatgattgtcactggagcagcccccgcgtcacca
acggttctgggattcctacgagcagctctggggtgccaggtctatgaaggttatgggcaa
actgaatgcacagctgggtgtaccttcacaacgccaggggactggacatcagggcatgta
ggggcacctctgccctgcaaccacatcaagctggtcgatgcagaggaactcaactactgg
acctgcaaaggagaaggagagatatgtgtgaaaggaccaaatgtgttcaaaggctactta
aaagacgaggacaggacaaaggaggccctggacagcgacggctggcttcacactggagac
attgggaaatggctgccggagggaacactcaaaatcattgatcggaaaaagcacatattt
aaacttgctcagggggaatatgttgcgccagagaagatcgagaacatctacatccggagt
gagcctgtggcacaaatctacgtccacggggacagcttaaaggcctttttggttggcatt
gtcgtgcctgaccctgaagtcatgccttcctgggctcagaagaaaggaatcgaagggacc
tatcaggaactctgcatgaaaaaggaattgaagaaagccattctggatgacatggtgatg
ctggggaaagaaagcggactgcattcttttgaacaggttaaagccatttacatccattgt
gacatgttctctgttcaaaatggtctgctgacaccaacactaaaggctaagagaccggag
ctgagagagtacttcaaaaagcaaatagaagagctttacttagtctccgtgtga

KEGG   Mus musculus (mouse): 328845
Entry
328845            CDS       T01002                                 

Gene name
Acsbg2, Bg, Bgr
Definition
(RefSeq) acyl-CoA synthetase bubblegum family member 2
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00071  Fatty acid degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04920  Adipocytokine signaling pathway
Module
mmu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    328845 (Acsbg2)
   00071 Fatty acid degradation
    328845 (Acsbg2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    328845 (Acsbg2)
   03320 PPAR signaling pathway
    328845 (Acsbg2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    328845 (Acsbg2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     328845 (Acsbg2)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   328845 (Acsbg2)
SSDB
Motif
Pfam: AMP-binding Cas_Cas2CT1978
Other DBs
NCBI-GeneID: 328845
NCBI-ProteinID: NP_001034203
MGI: 3587728
Ensembl: ENSMUSG00000024207
Vega: OTTMUSG00000031270
UniProt: Q2XU92
Position
17; 17 D
AA seq 667 aa
MTQEKKAEDLERGTDATSAVPRLWSTHCDGEVLLRLSKHGPGHETPMTIPELFQESAERF
SAYPALASKNGKKWDTLTFSQYYEMCRKAAKSLIKLGLQRFQCVGILGFNSVEWVVTALG
TILAGGLCVGIYATNSAEACQYVIQQANVSILIVENDQQLQKILLIPPDKMETVKAIVQY
KLPLMESMANLYSWNDFMELGNDIPNIQLDRVILSQKANQCAVILYTSGTTGTPKGVLLS
HDNITWTAGAMSQEMEINRVSGKQNTIVSYLPLSHIAAQLTDIWIPIKIGALTFFAQPDA
LRGTLVYTLQEVKPTLFMGVPRIWEKMQDTIKENVARSSRLRKKAFAWAKMLGLKVNTKR
MLGKRDIPMNYRMAKALVFAKVRTSLGLDNCHAFFSSASPLSQDVSEFFLSLDIPIGEIY
GMSECSGPHTVSNKSVYRVLSCGKVLSGCKNMLYNQNKEGVGEVCMWGRHVFMGYLNKEE
ATLEALDENGWLHSGDIGRLDSHDFLYITGRIKEILITAGGENVSPIPIETLVKEKIPII
SHAMLVGDKAKFLCMLLTLKCETDRKSGEPLNKLSVEAKSFCQMLGSQATTVSDILKSRD
QVVYTAIQYGIDIVNQQAMSDSHRIRKWIILEKDFSIQGGELGPTSKLKRSVITQKYKAQ
IDSMYLS
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgactcaagagaagaaggcggaagaccttgagagaggcacagacgccacctcagctgtt
cccaggctatggagcacccactgtgatggagaagtgctcctgaggttgtccaaacatggt
ccaggccatgagaccccgatgaccatccctgagctgttccaggaatctgctgagcgattc
agtgcttatccggccctagcctcaaagaacggcaaaaagtgggacacgctgacattcagc
cagtactatgaaatgtgtcgaaaggcagccaagtctctgatcaagctcggcctgcagcgc
ttccagtgtgtcggcatcctgggctttaactcggtcgagtgggtcgttactgctctgggc
actatcttggctgggggcctctgtgttggtatttatgccaccaactcggctgaggcctgc
cagtacgtcatccagcaggccaacgtgagtatcttgatagtggagaatgaccaacagctg
cagaaaatcctgttgattccaccagacaagatggagaccgtgaaagccattgtgcagtac
aagctgcccttgatggaaagcatggcaaacctgtactcatggaatgacttcatggagcta
gggaatgacatcccaaatatccagctggatcgggtcatcctgagccagaaggccaaccag
tgtgctgtcatcctctacacctctgggaccacagggacccccaaaggcgtgctgctgagc
catgacaatatcacatggacggcaggggcgatgtcgcaagagatggagataaaccgagtc
tcagggaagcagaatacaatagtcagctacctgcccctcagccacatcgcagcccagctc
acagacatctggatccccatcaagattggggcactcactttctttgctcaaccagatgca
ctcaggggcaccttggtgtacacgcttcaagaagtgaagcctacacttttcatgggggtg
ccacgcatctgggaaaagatgcaggacaccatcaaggaaaacgtggccaggtcctcccgc
ctgagaaagaaggcatttgcatgggcgaagatgcttggcttgaaggtcaacaccaagcgg
atgctggggaagcgagacatccccatgaattaccgcatggcaaaggcccttgtgttcgcg
aaggtcaggacctccctgggcttagacaattgccacgccttcttcagcagcgcttcgccc
ctctctcaggatgtctcagagttctttctcagcctggacatccccattggtgagatctac
gggatgagtgagtgctccggaccgcacacagtctccaacaagagtgtctacagagttttg
agctgtggcaaggtcctgagtggctgtaagaacatgctgtacaaccagaacaaagaaggc
gtgggtgaggtgtgcatgtggggccggcatgtcttcatgggctacctgaacaaggaggag
gccacattggaagcactggatgaaaatggctggctgcactctggggacattggccgcctg
gacagccatgatttcctttatatcactggccgcatcaaagaaatcctgataaccgctggt
ggtgagaatgtatcccccatccccattgagaccctggtaaaggagaagatccccattatc
agccacgccatgctggtgggcgacaaggccaaattcctgtgcatgctgctgacgctgaag
tgtgaaacagaccggaagagcggagagcccttgaacaagctgagcgtggaggccaaaagc
ttctgccagatgctgggtagccaagcaaccactgtgtcggacattttgaagagtcgagac
caagtggtctacacggccatccaatatggcatagacatcgtgaatcagcaagcgatgtct
gactcacatagaatccgaaagtggatcatcttggagaaggacttttcgatccagggtggg
gagctgggaccgacatcaaaacttaagagaagtgtgataacccagaaatacaaagcacag
attgacagcatgtacttgtcataa

KEGG   Mus musculus (mouse): 433256
Entry
433256            CDS       T01002                                 

Gene name
Acsl5, 1700030F05Rik, ACS2, ACS5, Fac, Facl5
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 5
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00071  Fatty acid degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
mmu04216  Ferroptosis
mmu04714  Thermogenesis
mmu04920  Adipocytokine signaling pathway
Module
mmu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    433256 (Acsl5)
   00071 Fatty acid degradation
    433256 (Acsl5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    433256 (Acsl5)
  09143 Cell growth and death
   04216 Ferroptosis
    433256 (Acsl5)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    433256 (Acsl5)
   03320 PPAR signaling pathway
    433256 (Acsl5)
  09159 Environmental adaptation
   04714 Thermogenesis
    433256 (Acsl5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    433256 (Acsl5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    433256 (Acsl5)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     433256 (Acsl5)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   433256 (Acsl5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   433256 (Acsl5)
  Exosomal proteins of breast cancer cells
   433256 (Acsl5)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 433256
NCBI-ProteinID: NP_082252
MGI: 1919129
Ensembl: ENSMUSG00000024981
UniProt: Q8JZR0 Q3UC67
Position
19; 19 D2
AA seq 683 aa
MLFIFNFLFSPLPTPALICLLTFGTAIFLWLINRPQPVLPLIDLDNQSVGIEGGARRGAF
QKNNDLILYYFSDAKTLYENFQRGLAVSDNGPCLGYRKPNQPYKWISYKQVSDRAEYLGS
CLLHKGYKSSQDQFVGIFAQNRPEWVISELACYTYSMVAVPLYDTLGTEAIIFVINRADI
PVVICDTPQKATMLVENVEKGLTPGLKTIILMDPFDDDLMKRGEKCGVEMLSLHDAENIG
KENFKKPVPPKPEDLSVICFTSGTTGDPKGAMLTHENVVSNMAAFLKFLEPIFQPTSDDV
TISYLPLAHMFERLVQGILFSCGGKIGFFQGDIRLLPDDMKALKPTVFPTVPRLLNRVYD
KVQNEAKTPLKKFLLNLAIISKFNEVKNGIIRRDSLWDKLVFSKIQGSLGGKVRLMITGA
APISTPVLTFFRAAMGCWVFEAYGQTECTGGCSITSPGDWTAGHVGTPVACNFVKLEDVA
DMNYFSVNNEGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIVDR
KKNIFKLAQGEYIAPEKIENVYSRSRPVLQVFVHGESLRSFLIGVVVPDPDSLPSFAAKI
GVKGSFEELCKNQCVKEAILEDLQKIGKEGGLKSFEQVKSIFVHPEPFTIENGLLTPTLK
AKRVELAKFFQTQIKSLYESIEE
NT seq 2052 nt   +upstreamnt  +downstreamnt
atgctttttatttttaacttcttgttttccccacttccaactccggccctgatctgcctc
ctgacgtttggaacggccatcttcctgtggctgatcaacagacctcagccagttttacct
ctcattgacttggacaaccagtctgtggggattgagggaggagcacggaggggcgctttc
cagaagaacaatgacctaatcctttattacttctcagacgccaagacgttgtatgaaaat
ttccaaagaggacttgctgtgtctgacaatgggccttgcttgggatacagaaagccaaac
cagccctacaaatggatctcctacaaacaggtgtctgatcgagcagagtacctgggctcc
tgtcttttgcataaaggatataagtcatcacaggaccaatttgttggcatctttgctcaa
aataggccagagtgggtcatctctgagttagcctgttacacatattccatggtagctgtc
cccctgtatgacacgctgggtacagaagccatcatctttgtcatcaacagggctgatatc
cctgtggtcatctgtgatacaccccaaaaggcaacaatgctagtagaaaatgtggaaaag
ggcctcacaccaggcctgaagacgatcatcctcatggacccttttgatgacgacctgatg
aaaagaggagaaaagtgtggagttgagatgttatccctgcatgatgcggagaatataggc
aaagagaacttcaaaaaaccagtgcctccgaagccagaggatctgagcgtcatctgtttc
accagtggaactacaggtgaccccaaaggagctatgctaacccatgaaaatgttgtttca
aacatggctgctttcctcaaatttctggagcctatcttccagcccacctctgatgatgtg
accatatcctaccttcccttggctcatatgtttgagaggcttgtccagggtatcttattt
tcctgtggaggcaaaattgggttcttccaaggagatatccggttgctacctgatgacatg
aaggctttgaaacccacagtgtttcctacagtgcctcgactccttaacagggtctatgat
aaggtacaaaatgaagccaagacacctttgaagaagttcttgttgaacttggctatcatc
agtaaattcaatgaagtgaaaaatggcatcattcggcgggacagtttgtgggacaagctc
gtgttttcaaagattcaaggaagcctgggggggaaggttcgcctcatgatcactggagcc
gcccccatctccactccagtcttgacattcttcagggctgcaatgggatgttgggtgttt
gaagcttatggccaaacagaatgcacaggtggatgttcaattacatcacctggggactgg
acagcaggtcatgttgggactccagtggcttgcaattttgtaaagctggaagatgtggct
gacatgaactacttttcagtaaacaacgaaggcgagatctgcatcaaaggtaacaatgtg
ttcaaaggctacctaaaggacccagagaaaacacaggaagtactggacaaggatggatgg
cttcacactggggacattggtcgctggcttccaaatggaactctgaaaattgttgaccgg
aagaagaatattttcaagttggcacaaggagaatacattgccccagagaagattgaaaat
gtttattccaggagcagaccagtattgcaagtttttgtccatggggagagcttacggtca
ttcctgatcggagtggtggttcccgacccagattcacttccctcatttgcagccaagatc
ggggtaaagggatcatttgaagaactgtgcaaaaaccaatgtgtaaaggaagccatttta
gaagacttgcagaaaattgggaaagagggtggcctgaaatcctttgagcaggtcaaaagt
atctttgtgcatccagagcccttcactattgaaaacggacttctgacaccgacactgaaa
gccaaacgagtagagcttgccaagttcttccagacacaaatcaagagcctctatgagagc
atcgaggagtag

KEGG   Mus musculus (mouse): 50790
Entry
50790             CDS       T01002                                 

Gene name
Acsl4, 9430020A05Rik, AC, ACS4, AU018108, Fac, Facl4, La, Lacs4
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 4
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00071  Fatty acid degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
mmu04216  Ferroptosis
mmu04714  Thermogenesis
mmu04920  Adipocytokine signaling pathway
Module
mmu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    50790 (Acsl4)
   00071 Fatty acid degradation
    50790 (Acsl4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    50790 (Acsl4)
  09143 Cell growth and death
   04216 Ferroptosis
    50790 (Acsl4)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    50790 (Acsl4)
   03320 PPAR signaling pathway
    50790 (Acsl4)
  09159 Environmental adaptation
   04714 Thermogenesis
    50790 (Acsl4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    50790 (Acsl4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    50790 (Acsl4)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     50790 (Acsl4)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   50790 (Acsl4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   50790 (Acsl4)
  Exosomal proteins of breast cancer cells
   50790 (Acsl4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 50790
NCBI-ProteinID: NP_997508
MGI: 1354713
Ensembl: ENSMUSG00000031278
Vega: OTTMUSG00000018811
UniProt: Q9QUJ7
Position
X; X F2
AA seq 711 aa
MNLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYR
SVTHFDSLAVIDIPGADTLDKLFDHAVAKFGKKDSLGTREILSEENEMQPNGKVFKKLIL
GNYKWINYLEVNCRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTL
YATLGREAVVHGLNESEASYLITSVELLESKLKAALVDINCVKHIIYVDNKTINRAEYPE
GLEIHSMQSVEELGAKPENLSVPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMT
GQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSK
GDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYVQKTLFKIGYDYKLEQIKKGYDAPLC
NLILFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEV
TDYTTGRVGAPLICCEIKLKDWQEGGYTVHDKPNPRGEIVIGGQNISMGYFKNEEKTAED
YCVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDN
ICAFAKSDQSYVISFVVPNQKKLTLLAQQKGVEGSWVDICNNPAMEAEILKEIREAANAM
KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMYGGK
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgaaccttaagctaaatgtgctcaccattatattgctgcctgtccacttgttaataaca
atatacagtgcccttatatttattccatggtattttcttaccaatgccaagaagaaaaac
gctatggcaaagagaataaaagctaagcccacttcagacaaacctggaagtccatatcgc
tctgtcacacacttcgactcactagctgtcatagacatccctggagcagatactctggat
aaattatttgaccatgctgtagccaaatttgggaagaaggacagccttggaacccgggag
atcctgagtgaagaaaatgaaatgcagccaaatggaaaggtttttaagaagttaattctt
gggaattataaatggataaactatcttgaagtgaactgcagagtgaataactttggaagt
ggcctcactgcattgggactgaaaccaaagaacaccattgccattttctgtgagaccagg
gcagagtggatgattgcagcacagacttgctttaagtacaactttccacttgtgacttta
tatgccacacttggcagagaagctgtagttcatggattaaatgaatctgaggcttcctat
ctgattactagtgttgagcttctggaaagcaaactgaaggcggccttagtagatatcaat
tgtgttaaacatatcatttatgtggataataagactatcaatagagcagagtaccctgag
gggcttgaaattcacagcatgcaatcagtagaggagctgggagccaagccagaaaacttg
agcgttcctccaagtagaccaaccccttcagacatggccattgtcatgtacaccagtggt
tctacgggccgccccaagggagtgatgatgcatcatagcaatttgattgctggaatgaca
ggccagtgtgaacgtatccctggactaggaccgaaggacacatatattggctacttacct
ttggctcatgtgctggaactgacagcagagatatcatgctttacctatggctgtaggatt
ggatactcttcaccccttacactgtctgaccagtccagcaaaatcaagaagggaagcaag
ggtgattgtactgtactgaaacccacacttatggccgctgttccggaaatcatggataga
atttataagaatgttatgagcaaggttcaagagatgaattatgttcagaaaactctattt
aaaatcgggtatgattacaaattagagcaaatcaagaaaggctatgacgcccctctttgt
aatctgatactgtttaaaaaggtgaaggctctgctgggagggaatgtccgcatgatgctg
tctggcggcgcgccactgtcccctcagacacaccgattcatgaatgtctgcttctgctgc
cccattggtcagggatatgggctgacagaatcatgtggtgctggaacagttactgaagtt
actgactacactactggaagagttggagctcctcttatttgctgtgaaattaaactgaaa
gactggcaggaaggtggttatacagttcatgataagccgaaccccagaggtgagattgtg
atcggtggccagaatatctccatgggatattttaaaaacgaagagaaaacagcagaagat
tattgtgttgatgaaaatggacaaaggtggttttgcactggcgatattggagaattccat
cctgatggatgcttacagattatagatcgtaagaaagatctggtaaagttacaagcagga
gaatatgtatctcttgggaaagtagaagctgcactgaagaattgtccactgatcgacaac
atctgtgcttttgccaaaagtgaccagtcctatgtgatcagttttgtggttcctaaccag
aaaaagttgactcttttggcacaacagaagggggtagaaggatcttgggttgatatttgc
aataatcccgccatggaagctgaaatactgaaagaaattcgagaagctgcaaatgccatg
aaattggagcgatttgaaattccgatcaaggttcggttaagcccagagccatggaccccc
gagactggtttggtaacagatgccttcaagctgaaaaggaaggagttgaagaaccattat
ctcaaagacattgagcgaatgtatgggggcaaataa

KEGG   Mus musculus (mouse): 74205
Entry
74205             CDS       T01002                                 

Gene name
Acsl3, 2610510B12Rik, Acs3, C85929, Facl3, LACS_3, Pro2194
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00071  Fatty acid degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
mmu04216  Ferroptosis
mmu04714  Thermogenesis
mmu04920  Adipocytokine signaling pathway
Module
mmu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    74205 (Acsl3)
   00071 Fatty acid degradation
    74205 (Acsl3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    74205 (Acsl3)
  09143 Cell growth and death
   04216 Ferroptosis
    74205 (Acsl3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    74205 (Acsl3)
   03320 PPAR signaling pathway
    74205 (Acsl3)
  09159 Environmental adaptation
   04714 Thermogenesis
    74205 (Acsl3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    74205 (Acsl3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    74205 (Acsl3)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     74205 (Acsl3)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   74205 (Acsl3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   74205 (Acsl3)
  Exosomal proteins of breast cancer cells
   74205 (Acsl3)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 74205
NCBI-ProteinID: NP_001028778
MGI: 1921455
Ensembl: ENSMUSG00000032883
Vega: OTTMUSG00000033118
UniProt: Q9CZW4
Position
1 C4; 1 40.84 cM
AA seq 720 aa
MNNHVSSTPSTMKLKQTINPILLYFIHFIISLYTILTYIPFYFLCESKQEKPNQIKAKPV
SSKPDSAYRSINSVDGLASVLYPGCDTLDKVFMYAKNKFKNKRLLGTREILNEEDEIQPN
GKIFKKVILGHYNWLSYEDVFIRALDFGNGLQMLGQKPKANIAIFCETRAEWMIAAQACF
MYNFQLVTLYATLGGPAIVHGLNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGK
PPTWSEFPKGVIVHTMAAVQALGVKANVEKKAHSKPLPSDIAVIMYTSGSTGIPKGVMIS
HSNIIASITGMARRIPRLGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQ
SSKIKKGSKGDTSVLKPTLMAAVPEIMDRIYKNVMNKVNEMSAFQRNLFILAYNYKMEQI
SKGCSTPLCDRFVFRNVRRLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTES
TGAGTITEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQNVTMGYY
KNEAKTKTDFFEDENGQRWLCTGDIGEFDPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAA
LKNLPLIDNICAYANSYHSYVIGFVVPNQKELTELARTKGFKGTWEELCNSSEMENEVLK
VLSEAAISASLEKFEIPLKIRLSPDPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK
NT seq 2163 nt   +upstreamnt  +downstreamnt
atgaataaccacgtatcttcaacaccatcaaccatgaagctaaaacaaaccatcaacccc
atacttttatatttcatacattttataatatcactctatactattttaacatacatccca
ttttattttttgtgtgagtcaaaacaagagaaaccaaaccaaattaaagcaaaacctgtc
agttccaaaccggactctgcatacagatctatcaacagtgtggatggcttggcttcagtg
ctgtatcctggctgcgatacacttgataaagtctttatgtatgcaaaaaacaaatttaaa
aacaaaagactattgggaacacgtgaaattttaaatgaggaagatgaaatacagccaaat
ggaaaaatttttaaaaaggttattctggggcactataattggctttcctatgaagatgtc
ttcatccgagcccttgactttggaaatgggttacaaatgttgggccagaaaccaaaggcc
aacatcgccatcttctgtgagaccagggctgagtggatgatcgctgcacaggcgtgtttt
atgtataacttccagcttgttacactgtatgctactctgggaggtccagccattgttcat
ggactgaatgagacagaggtgaccaacatcattactagcaaagaactcttgcaaacaaag
ctgaaggatatagtctctttggtcccacgtctgcggcatatcattactgttgatgggaag
cctccaacctggtctgagttccccaaaggtgtcattgtacacaccatggctgcagtgcag
gctctaggagtgaaggccaacgtggaaaagaaagctcacagcaaaccactgccctcagat
attgcagtaatcatgtacacaagtgggtccacaggaattccaaagggagtcatgatctca
cacagcaacatcattgcttctataacggggatggcgagaaggattccaagactgggagag
gaagatgtgtatattggctacttgcccctggcacatgttctagaattaagtgctgagctt
gtgtgtctttctcatggatgccgaatcggctactcttcaccacagacattagcagatcag
tcttcaaaaataaaaaaaggaagcaaaggagacacatccgtgctgaagccaacactgatg
gcagctgttccggaaatcatggatcggatctacaaaaatgtcatgaataaagtgaatgaa
atgagtgcttttcaacgaaacttgtttattttggcatataattataagatggaacagatt
tcaaaagggtgtagtactccactgtgtgaccgctttgttttccggaatgtccgaaggctg
ctgggtggaaatattcgccttttactgtgtggtggtgctccgctttctgcaacaacgcag
cgattcatgaatatctgtttctgctgtcccgttggtcaggggtatggactcacagaatct
actggggctggaacaattacagaagtgtgggactacaataccggcagagtgggagcacca
ttagtttgctgtgaaatcaaattaaagaactgggaggaaggtggctattttaatactgac
aaaccacatcccagaggtgaaattcttattggtggccaaaatgtgacaatggggtactac
aaaaatgaagcaaaaacaaagacagatttctttgaagatgaaaatggacagcggtggctg
tgcactggagatattggagagtttgaccctgacggctgtctgaagatcattgaccgtaaa
aaggaccttgtgaaactacaggcaggagagtacgtttctctcgggaaagtagaggcagct
ttgaagaacctcccactgatagataacatttgtgcgtatgcaaacagctaccattcttac
gtaattgggtttgttgtgccaaatcaaaaggaacttacagagctagctagaacaaaagga
tttaaaggaacttgggaagagctgtgtaacagcagcgagatggaaaatgaggtccttaaa
gtgctttctgaagctgctatttcagcaagtctggaaaagtttgaaattccactaaaaata
cgtttgagccctgacccatggactcccgaaactggtctggtgacagatgccttcaagttg
aaacgtaaagagcttaaaacacactaccaggcagacattgagcggatgtatggaagaaaa
taa

KEGG   Mus musculus (mouse): 78625
Entry
78625             CDS       T01002                                 

Gene name
Acsbg3, 1700026H02, 1700061G19Rik, AI507598
Definition
(RefSeq) acyl-CoA synthetase bubblegum family member 3
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00071  Fatty acid degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04920  Adipocytokine signaling pathway
Module
mmu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    78625 (Acsbg3)
   00071 Fatty acid degradation
    78625 (Acsbg3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    78625 (Acsbg3)
   03320 PPAR signaling pathway
    78625 (Acsbg3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    78625 (Acsbg3)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     78625 (Acsbg3)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   78625 (Acsbg3)
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 78625
NCBI-ProteinID: NP_084417
MGI: 1925875
Ensembl: ENSMUSG00000024209
Vega: OTTMUSG00000031269
UniProt: Q08EE8
Position
17; 17 D
AA seq 705 aa
MTDPKESDNLQTSRRILKTKTILKNKIHSAISKKAQADNFEILTPGSSYWTSKREGQVQL
RMGKDPLDNEPPVTVPDLIMSAATKYSHYLAIGSKYKKSWQLLTYIEYYEACRRAAKAFL
KVGLERFHGVGIMGINSSEWVIASIGAIMAGGISVGILSSISPKACQVIAETSEMDIFVV
DNDRQLQKINQIQGYLKHLKAIIQYREDIQEAQPNLYSWKGFLDLADGISDEKLDKIIDT
LKPNQCCALVYNQGTTGPSKAIMLSHDNITWTTAAIVQSLGFKCPPQGQEILVSYLPLCF
PGIQILDVWVAISVAGTVYFPSLDSGKWSGLPRTPGTGFLMELLREVQPTTFCGIPWVWD
RMLDSLKTKFLDSTAFRRRIDHWAMRMGLHTNKKLMMGEIHQPLCFGLAKRLTFERARKF
LGLNHCQQFLNMGMGLPSGTLDFFLSVNIPIMELYGLSECTGLHTVSNLQAYRILSAGKA
LPKTHTKVEKENKDGIGNLCIWGRHIFMGYLRDKQSTERKVDTHGWLHTNDLGFLDFDKF
LYVMGNNNDLIKLSSGEMVNPYPIEERVRTRIPIVRYAMLVGQDAPYLCALLTLKCQINP
ETGEARSNLTSEVVACCRKLRSQSTWLSDVLYDRDPLVTEFINQGIEDVNSEAPTMGAKI
IKWVILDNDFSVDGGELGPMSKMNRSIVVKIYQEEIQKLYETSTS
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgactgaccctaaggaatcagataaccttcagacctccaggaggatcctgaaaaccaaa
accatcttgaagaacaaaattcacagtgcaatatcgaagaaggcacaagcagataacttt
gagatactgaccccaggttccagctactggacatctaagcgagaaggccaggtgcagctg
cgcatgggcaaggacccactagataacgagcctccggtcacagttcccgacttgatcatg
agcgcggccactaagtactcacactacctggcgatcggttccaagtacaagaaaagctgg
caactgctcacctacatcgagtactacgaggcctgccggcgtgctgccaaggccttcctc
aaggtgggtctggaacgctttcatggtgtgggtatcatgggcatcaattcctcggagtgg
gtgattgccagcattggagctatcatggcaggtggcatctctgtgggcatcttgagcagc
atctcccccaaagcctgccaagtcatcgctgagacctcagaaatggatatctttgtggtg
gataatgacagacagctgcaaaagattaaccagatccagggctacttgaagcatctcaag
gccatcatacagtacagagaagatatccaggaagcgcagccaaatctatactcgtggaaa
ggcttcctggacctcgcggatggcatctcggatgaaaaactggacaaaatcatcgacaca
ctgaagcccaatcagtgctgtgctttggtatataaccagggtaccacagggccctcgaag
gccataatgctgagccatgacaacatcacatggaccacagcagccatcgttcaaagcctt
gggttcaagtgtccacctcagggtcaggagatcctcgtgagctacctgccactttgcttc
cctggaatacagatcttggacgtttgggtggccatttccgtggctgggacagtctatttc
ccctcgctagactcagggaagtggagtgggctgccacgaacccctggcacgggcttcctg
atggagctgctccgcgaggtccagcccaccacgttctgcggcattccgtgggtgtgggac
cgcatgctggacagtctgaagaccaaattcctggactccaccgccttccgcaggaggatc
gaccattgggccatgcgcatgggcctccacaccaacaagaagctgatgatgggggagatc
caccagccgctgtgcttcggcctggccaagagattgaccttcgagcgcgccaggaagttc
ctgggtctcaaccattgccagcagtttctaaacatgggcatggggctgccgagtggcacg
ctggatttcttcctcagcgtaaacatccctatcatggagttgtacggcttgtcggagtgc
acgggactacacacagtgtccaacctgcaggcttaccggatactgagcgctgggaaagcg
cttcccaaaacccacacaaaggtggaaaaagaaaacaaggatgggatcgggaacttgtgt
atctggggccgccacatattcatggggtacctcagagacaagcagagcacagagaggaag
gtggacacccacggctggctacacacgaacgacttgggcttcttggattttgacaagttc
ctctatgtcatggggaacaataacgatttgatcaagctgagctcgggggaaatggtcaac
ccgtatcccatcgaggagcgggtaaggacgcgaatccccatcgtccgctatgccatgctg
gtgggccaggacgccccgtacctgtgcgccctcctcacattgaagtgtcagataaatcca
gagactggagaggctcggagtaacctgaccagtgaggtcgtcgcttgctgtcggaagctt
cgaagccagtcgacctggttgtcagacgtcctatatgaccgtgaccctttggtcacggag
ttcattaaccagggcatcgaggatgtgaattcggaggcgcccacaatgggtgccaagatc
attaagtgggtcattctagacaacgatttctctgtggatggtggggagcttggacccatg
agcaagatgaacaggtccattgtggtcaagatataccaagaggaaatccagaaactctat
gagacttcgacctcctag

KEGG   Mus musculus (mouse): 94180
Entry
94180             CDS       T01002                                 

Gene name
Acsbg1, BG1, Bgm, E230019G03Rik, GR-LACS, L, Lpd, R75185
Definition
(RefSeq) acyl-CoA synthetase bubblegum family member 1
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00071  Fatty acid degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04920  Adipocytokine signaling pathway
Module
mmu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    94180 (Acsbg1)
   00071 Fatty acid degradation
    94180 (Acsbg1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    94180 (Acsbg1)
   03320 PPAR signaling pathway
    94180 (Acsbg1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    94180 (Acsbg1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     94180 (Acsbg1)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   94180 (Acsbg1)
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 94180
NCBI-ProteinID: NP_444408
MGI: 2385656
Ensembl: ENSMUSG00000032281
Vega: OTTMUSG00000030280
UniProt: Q99PU5
Position
9; 9 A5.3
AA seq 721 aa
MPRGSEAGYCCLSRDSNMPDSRDDQQQGASLGTSQDNSQTSSLIDGQTLSKESPSHGLEL
SAPEKARAASLDGAEEALWTTRADGRVRLRLEPFCTQRPYTVHQMFYEALDKYGNLSALG
FKRKDKWERISYYQYYLIARKVAKGFLKLGLERAHSVAILGFNSPEWFFSAVGTVFAGGI
VTGIYTTSSPEACQYISHDCRANVIVVDTQKQLEKILKIWKDLPHLKAVVIYQEPPPKKM
ANVYTMEELIELGQEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTA
RYGSQAGDIQPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFADPDALKGTLVNT
LREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPSNDLKPF
TSRLADYLVLARVRQALGFAKCQKNFYGAAPMTAETQRFFLGLNIRLYAGYGLSESTGPH
FMSSPYNYRLYSSGRVVPGCRVKLVNQDADGIGEICLWGRTIFMGYLNMEDKTCEAIDSE
GWLHTGDMGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISSAMLIGDQ
RKFLSMLLTLKCTLDPETSEPTDSLTEQAVEFCQRVGSKASTVSEIVGQRDEAVYQAIHE
GIQRVNANAAARPYHIQKWAILQRDFSISGGELGPTMKLKRLTVLEKYKDIIDSFYQEQK
Q
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgccacgcggttctgaagcaggatactgctgtctgtccagggactccaacatgcctgac
agcagagatgatcagcagcagggggccagcttggggacctcccaagacaactcgcaaacc
agctccttaattgatgggcaaacactctccaaagagtctccaagtcacggtctcgagctc
tcagctccagaaaaggcaagggctgcctctttggatggtgcagaggaagcactatggaca
acccgggcggatgggagagtgcgcctgcgcctggaacctttctgtactcagcgtccctat
accgtgcaccagatgttctacgaggccctagataagtacgggaacctcagtgctctgggc
ttcaagcgcaaggacaagtgggagcgtatctcttactaccagtactacctgattgcacgc
aaagtagccaaaggcttcttgaagctcggcctagagcgtgcccacagcgtggcgatcctt
ggcttcaactctccagaatggttcttctctgcagtgggcacagtgttcgcagggggcatt
gtcactggcatctacaccaccagctccccggaggcctgccagtacatctctcatgactgc
cgagccaatgtcatcgtggttgacacacagaagcagctggaaaagatcctgaagatctgg
aaagacttgccacatctaaaggcagtggtgatataccaagaaccccctccaaagaagatg
gctaacgtgtacacgatggaggagctcatagaactggggcaagaagtgcctgaggaggcc
ctagatgccatcatcgatacccagcaacccaaccagtgctgtgtgctcgtctacacatca
ggcaccacgggaaaccccaagggtgtgatgctgagtcaagacaatatcacatggacagca
cggtatggcagtcaggctggggacatccagccagcagaagtgcagcaggaggtagtggtc
agctacttgcctctcagccacatcgctgcccagatctacgacctgtggacaggcatccag
tggggagcccaggtctgctttgcagatccggacgccctgaaggggaccctggtaaacaca
ctgcgggaggtggagcccacatcccacatgggagtgccgcgtgtgtgggagaagatcatg
gaaaggatccaggaggtggccgctcagtctggcttcatccgccgcaagatgctgctgtgg
gccatgtcagtcaccttggaacagaaccttacctgccctagcaatgacctgaagcccttc
accagcagactggcggattacctagtgttagccagggtccgtcaggctctgggctttgcc
aagtgtcagaaaaacttctacggagcagctccgatgacggcagagacgcagcgcttcttc
ctgggcctcaacatccgcctgtatgcaggctatggcctcagcgagagcacaggcccccac
ttcatgtccagcccctacaactatcggctttacagctccggcagggtggtacccggctgc
cgggtgaagctggtgaatcaggatgcagatggcatcggtgagatctgcctgtggggccgc
accatcttcatgggttatctgaacatggaggacaaaacctgtgaggccattgattcggaa
ggctggctgcacacaggtgacatgggccgcctggatgctgacggcttcctctacatcacc
gggcgcctcaaagaattaatcatcactgcgggcggcgagaacgtgcccccagtgcctatc
gaggaggccgtgaagatggagctgcccatcatcagcagtgccatgctgatcggggaccag
aggaagttcctgtccatgctgctaaccctgaagtgcacgctggacccagagacgtctgag
cctacagacagcctgaccgagcaagctgtggagttctgccagcgggtgggcagcaaggcc
agcaccgtctccgagatcgtggggcagagagacgaggctgtgtaccaggccattcacgaa
gggatccagagggtgaacgcgaacgccgcagcccggccctaccacatccagaagtgggcc
attctccaacgtgacttctccatttcaggtggagaactgggacccaccatgaaattgaaa
cggctcacggttctggagaagtacaaagatatcatcgattctttttatcaagagcaaaaa
cagtag

DBGET integrated database retrieval system