KEGG   Mus musculus (house mouse): 140810
Entry
140810            CDS       T01002                                 
Symbol
Ttbk2, 2610507N02Rik, B930008N24Rik, TTK, Ttbk, Ttbk1, mKIAA0847
Name
(RefSeq) tau tubulin kinase 2
  KO
K08815  tau tubulin kinase [EC:2.7.11.26]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    140810 (Ttbk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     140810 (Ttbk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CK1 group
  TTBK family
   140810 (Ttbk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 140810
NCBI-ProteinID: NP_001020027
MGI: 2155779
Ensembl: ENSMUSG00000090100
UniProt: Q3UVR3
Position
2:complement(120563297..120681065)
AA seq 1243 aa
MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQV
LKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLR
LGKQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCFMLDFGLARQFTNSCGDVRPP
RAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKE
RYDHRLMLKHLPPEFSTFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWEKS
GTDGSLTTTTTSATPQLHTRLTPAAIGIANATPIPGDLLRENTDEVFPDEQLSDGENGIP
VGVSPDKLPGSLGHPRPQEKDVWEEMDINKNKIKLGICKAATEEENSHGQVNGILNAPSL
GSPIRVRSEITQPDRDVPLVRKLRSIHSFELEKRLTLEPKPDTDKFLETCMEKMQKDSSA
GKEPVPPALPHKPCVPVVTHTDHIWHYDDEYLPDASKPASANTPEQADGGGSNGFIAVNL
SSCKQEVDSKEWVIVDKEQDLQDFRTNEVLGHKTTGSPSDEEPEVLQVLEGSPQDEKIQV
GPWTDNHHLKKESSGVVLALSAECPATAASELYTDRLDLQAGAASQFITVTPTSPMEAQA
EGPLTAITIPRPSVASTQSTSGSFHYGPQPEKKDLQPLEPTVELYSPRENFSGLVVTEGE
LASGGSRVDLGLQIDHTGHDMLPNMRDGDTSQDLGPKDPPDHNRLAVKEFEHLPGETEER
SLLLGSENEDERLSKGQHCIEVSSPGELVTAERAQLAATEPLHVSETQNCSVLPNQDKTH
EIMKLLAVGTSEISPQAIDPHAEGQIGQMAAMQKNKLFKDDGIQSESLPRQQGDLSAFLH
QEGKREKVVPRNGELYHCVSENEHGPPTRKDMLRSSFVTRHSRIPVLAQEIDSTFESSSA
ISAKEKLLQKKAYQPEIVKLLVEKRQFKSFLGDLSSASDKLIEEKLAAVPVPFSEEEVFA
PFSRLAADSHLSRSVEDSFLSPIISQARKSKIPRPVSWVSTDQINGSASPQFLPRPPPGK
PPVRPGVEARLRRYKVLGSSNSDSDLFSRLAQILQNGSQKSRSTTQCKSPGSPHNPKTPP
KSPVVPRRSPSASPRSSSLPRTSSSSPSRAGRPHHDQRSSSPHLGRSKSPPSHSGSSSSR
RSCQQEHCKPSKNGPKGSGSLHHHSTSSKTPPGKSKPASKLSR
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgagtggaggaggagagcagccagatatcctcagtgttggaatcctggtcaaagaaaga
tggaaagtgttaagaaagattggaggtgggggctttggagaaatttacgatgccttggac
atgctcaccagggagaatgtggcgctgaaggtggagtcagctcagcagccaaagcaggtt
ctgaagatggaggttgctgtgttgaagaaactgcaagggaaagaccatgtttgtagattt
attggctgtgggagaaatgatcgtttcaactacgtggtcatgcaattgcagggacggaat
ctggcagatctccgccgtagccaatcccggggcacattcactattagcactacccttcgt
cttgggaaacagattctggagtctattgaaagcatacattctgtgggattccttcacaga
gacatcaaaccgtcaaacttcgccatgggacgtttccccagtacatgtaggaaatgtttc
atgcttgattttggcttggctcgacaatttactaattcctgtggtgacgtcagaccacct
cgtgctgtggcaggctttcgagggacagttcgttatgcatcaatcaatgctcatcggaac
agggaaatgggaagacatgatgacctttggtctttattctacatgttggtggagtttgtg
gttggccaactgccttggagaaaaataaaggacaaggagcaagtaggctccattaaggag
agatatgaccacaggctcatgttaaaacacctccctccagaattcagcacctttcttgac
catatttcctctttggattattttacaaaaccggactaccagcttctaacatccgtgttt
gacaatagcatcaagacctttggagtaattgagagtgacccgtttgactgggagaagagt
ggaactgatggctccctgacaaccaccaccacctctgccacccctcagctgcacacccgc
ctgacccctgctgctatcggaattgcaaatgccacccccatcccaggagacttgcttcga
gaaaatacagatgaagtgtttccagatgaacagcttagtgatggggagaacggaatccct
gttggtgtatcaccagataaattgcctggatctctggggcacccacgccctcaggaaaag
gatgtctgggaagagatggatatcaacaagaacaagataaagctgggaatttgcaaagca
gctactgaagaagaaaatagccatggtcaagtaaatggcatactcaatgctccaagcctt
ggttcaccaattcgtgtccgatcagagattactcagccagacagagatgttccgttagta
aggaagctacgttctattcacagctttgagctggaaaaacgtttgacacttgagccaaag
ccagatactgacaagtttctggagacctgcatggagaaaatgcagaaagattccagtgca
ggaaaagaacctgtcccccctgctctgcctcataagccgtgtgtccccgtcgtgacccac
actgaccacatctggcactatgatgacgaatatcttcctgatgcctccaagcctgcctct
gccaacaccccggagcaggcagatggtggtggcagcaacggatttatagctgttaactta
agctcttgcaaacaggaggttgattccaaagaatgggtgattgtggacaaggagcaagac
cttcaggactttaggacaaatgaggtgttaggccataagacaactggaagcccttcagat
gaggagcctgaagtgcttcaggtccttgagggatcacctcaagatgaaaagatccaagta
ggtccttggactgacaaccatcacttaaagaaggaaagctcaggtgtggttttagcactt
tctgctgaatgccctgctactgctgcttcagaactgtacacagataggctagacctccag
gctggagctgcaagtcagttcatcacagtgactcccacaagtcccatggaggcacaagca
gaaggacccctgactgcgattacaattcctagaccttctgtggcatcaacacagtcaact
tcaggaagctttcactatggcccacaaccagagaagaaagatcttcagcccttggagccc
actgtagaactgtactctccaagggagaacttctccggcttggttgtgacagagggtgaa
ctagctagcggaggaagcagagtggatttgggacttcagatagatcacactggtcatgac
atgttacccaacatgagagatggtgacacatctcaagacttgggaccaaaagaccctcct
gaccataatagattagctgtgaaagaatttgaacatctccctggagaaacagaagagaga
agccttcttctgggctcagagaatgaagatgagaggttaagtaaagggcagcactgtatt
gaagtctcttccccaggagagttagtgactgcagagagggctcagttagctgccacagaa
cctctgcatgtatcagagacacagaactgtagtgtgctaccaaatcaggacaaaacccat
gagataatgaagcttttggcagttggaacttcagaaatttctcctcaagccattgaccca
catgctgaagggcagataggccagatggcagcaatgcagaaaaataagctatttaaagat
gatggtattcagagtgaaagcttgccaaggcagcagggagacctctctgcttttttgcac
caagagggtaagagagagaaagttgtccctagaaatggagagctctatcattgtgtctca
gagaatgagcatggtcctcctactcggaaggacatgctccggtcatcctttgtgaccagg
cacagccggatccctgttttagcacaagaaatagactcaacttttgaatcatcctctgct
atttctgcaaaagaaaagcttctacagaagaaagcctatcagccagaaatagtcaaactt
cttgtagaaaaaaggcagttcaagtctttcctgggagacctctcaagtgcctctgataag
ctgatagaggagaaactagccgctgttccagtccctttttctgaggaggaagtcttcgct
cccttttctagactggcagcagattcccacctgagtagatcagttgaagatagctttctg
tcacccatcatctcccaggctagaaagagcaagattccaaggccagtatcctgggtcagc
acagatcaaattaatggctccgcttcacctcagttcttgcctcggccaccaccaggaaag
ccaccagtcaggcctggagtagaagccaggctacgcagatataaagttctagggagtagt
aactctgactcagaccttttctctcgcctggcccaaattcttcaaaatggatctcagaaa
tcccggagtactacccaatgcaagagcccaggatctcctcacaatccaaaaacaccaccc
aagagtccagttgtacctcgaaggagtcccagtgcctctcctcgaagctcatccttgcct
cgaacatctagttcctcaccatctagggctggacggccccaccatgaccagaggagttct
tccccacatctggggagaagcaagtcaccccctagccactcaggatcatcgtcctccagg
aggtcctgccaacaggagcattgcaaacccagcaagaatggcccaaaaggatctggcagc
ctccaccaccactcaaccagctctaaaactcccccagggaagagtaagccagccagtaaa
ctcagcagatag

DBGET integrated database retrieval system