KEGG   Mus musculus (mouse): 14082Help
Entry
14082             CDS       T01002                                 

Gene name
Fadd, Mort1/FADD
Definition
(RefSeq) Fas (TNFRSF6)-associated via death domain
  KO
K02373  FAS-associated death domain protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05010  Alzheimer disease
mmu05142  Chagas disease (American trypanosomiasis)
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    14082 (Fadd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    14082 (Fadd)
   04215 Apoptosis - multiple species
    14082 (Fadd)
   04217 Necroptosis
    14082 (Fadd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    14082 (Fadd)
   04621 NOD-like receptor signaling pathway
    14082 (Fadd)
   04622 RIG-I-like receptor signaling pathway
    14082 (Fadd)
   04657 IL-17 signaling pathway
    14082 (Fadd)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    14082 (Fadd)
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    14082 (Fadd)
  09167 Infectious diseases
   05152 Tuberculosis
    14082 (Fadd)
   05161 Hepatitis B
    14082 (Fadd)
   05168 Herpes simplex infection
    14082 (Fadd)
   05163 Human cytomegalovirus infection
    14082 (Fadd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14082 (Fadd)
   05165 Human papillomavirus infection
    14082 (Fadd)
   05142 Chagas disease (American trypanosomiasis)
    14082 (Fadd)
  09168 Drug resistance
   01524 Platinum drug resistance
    14082 (Fadd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death DED
Motif
Other DBs
NCBI-GeneID: 14082
NCBI-ProteinID: NP_034305
MGI: 109324
Ensembl: ENSMUSG00000031077
Vega: OTTMUSG00000033373
UniProt: Q61160
Structure
PDB: 

Position
7 F5; 7 88.85 cM
AA seq 205 aa AA seqDB search
MDPFLVLLHSLSGSLSGNDLMELKFLCRERVSKRKLERVQSGLDLFTVLLEQNDLERGHT
GLLRELLASLRRHDLLQRLDDFEAGTATAAPPGEADLQVAFDIVCDNVGRDWKRLARELK
VSEAKMDGIEEKYPRSLSERVRESLKVWKNAEKKNASVAGLVKALRTCRLNLVADLVEEA
QESVSKSENMSPVLRDSTVSSSETP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggacccattcctggtgctgctgcactcgctgtccggcagcctgtcgggcaacgatctg
atggagctcaagttcttgtgccgcgagcgcgtgagcaaacgaaagctggagcgcgtgcag
agtggcctggacctgttcacggtgctgctggagcagaacgacctggagcgcgggcacacc
gggctgctgcgcgagttgctggcctcgctgcgccgacacgatctactgcagcgcctggac
gacttcgaggcggggacggcgaccgctgcgcccccgggggaggcagatctgcaggtggca
tttgacattgtgtgtgacaatgtggggagagactggaaaagactggcccgcgagctgaag
gtgtctgaggccaagatggatgggattgaggagaagtacccccgaagtctgagtgagcgg
gtaagggagagtctgaaagtctggaagaatgctgagaagaagaacgcctcggtggccgga
ctggttaaggcgctgcggacctgcaggctgaatctggtggctgacctggtggaagaagcc
caggaatctgtgagcaagagtgagaatatgtccccagtactaagggattcaactgtgtct
tcctcagaaacaccctga

DBGET integrated database retrieval system