KEGG   Mus musculus (mouse): 14082Help
Entry
14082             CDS       T01002                                 

Gene name
Fadd, Mort1/FADD
Definition
(RefSeq) Fas (TNFRSF6)-associated via death domain
  KO
K02373  FAS-associated death domain protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05010  Alzheimer disease
mmu05142  Chagas disease (American trypanosomiasis)
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    14082 (Fadd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    14082 (Fadd)
   04215 Apoptosis - multiple species
    14082 (Fadd)
   04217 Necroptosis
    14082 (Fadd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    14082 (Fadd)
   04621 NOD-like receptor signaling pathway
    14082 (Fadd)
   04622 RIG-I-like receptor signaling pathway
    14082 (Fadd)
   04657 IL-17 signaling pathway
    14082 (Fadd)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    14082 (Fadd)
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    14082 (Fadd)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    14082 (Fadd)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    14082 (Fadd)
   05161 Hepatitis B
    14082 (Fadd)
   05160 Hepatitis C
    14082 (Fadd)
   05168 Herpes simplex infection
    14082 (Fadd)
   05163 Human cytomegalovirus infection
    14082 (Fadd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14082 (Fadd)
   05169 Epstein-Barr virus infection
    14082 (Fadd)
   05165 Human papillomavirus infection
    14082 (Fadd)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    14082 (Fadd)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    14082 (Fadd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death DED
Motif
Other DBs
NCBI-GeneID: 14082
NCBI-ProteinID: NP_034305
MGI: 109324
Ensembl: ENSMUSG00000031077
Vega: OTTMUSG00000033373
UniProt: Q61160
Structure
PDB: 

Position
7 F5; 7 88.85 cM
AA seq 205 aa AA seqDB search
MDPFLVLLHSLSGSLSGNDLMELKFLCRERVSKRKLERVQSGLDLFTVLLEQNDLERGHT
GLLRELLASLRRHDLLQRLDDFEAGTATAAPPGEADLQVAFDIVCDNVGRDWKRLARELK
VSEAKMDGIEEKYPRSLSERVRESLKVWKNAEKKNASVAGLVKALRTCRLNLVADLVEEA
QESVSKSENMSPVLRDSTVSSSETP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggacccattcctggtgctgctgcactcgctgtccggcagcctgtcgggcaacgatctg
atggagctcaagttcttgtgccgcgagcgcgtgagcaaacgaaagctggagcgcgtgcag
agtggcctggacctgttcacggtgctgctggagcagaacgacctggagcgcgggcacacc
gggctgctgcgcgagttgctggcctcgctgcgccgacacgatctactgcagcgcctggac
gacttcgaggcggggacggcgaccgctgcgcccccgggggaggcagatctgcaggtggca
tttgacattgtgtgtgacaatgtggggagagactggaaaagactggcccgcgagctgaag
gtgtctgaggccaagatggatgggattgaggagaagtacccccgaagtctgagtgagcgg
gtaagggagagtctgaaagtctggaagaatgctgagaagaagaacgcctcggtggccgga
ctggttaaggcgctgcggacctgcaggctgaatctggtggctgacctggtggaagaagcc
caggaatctgtgagcaagagtgagaatatgtccccagtactaagggattcaactgtgtct
tcctcagaaacaccctga

DBGET integrated database retrieval system