KEGG   Mus musculus (mouse): 14085
Entry
14085             CDS       T01002                                 

Gene name
Fah, sw, swst
Definition
(RefSeq) fumarylacetoacetate hydrolase
  KO
K01555  fumarylacetoacetase [EC:3.7.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00350  Tyrosine metabolism
mmu01100  Metabolic pathways
Module
mmu_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    14085 (Fah)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14085 (Fah)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.2  fumarylacetoacetase
     14085 (Fah)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   14085 (Fah)
SSDB
Motif
Pfam: FAA_hydrolase FAA_hydrolase_N
Other DBs
NCBI-GeneID: 14085
NCBI-ProteinID: NP_034306
MGI: 95482
Ensembl: ENSMUSG00000030630
Vega: OTTMUSG00000025072
UniProt: P35505
Structure
PDB: 
1HYO 2HZY 1QQJ 1QCO 1QCN

Position
7 D3; 7 48.36 cM
AA seq 419 aa
MSFIPVAEDSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQILDLSVIKHLFTGPALSKHQH
VFDETTLNNFMGLGQAAWKEARASLQNLLSASQARLRDDKELRQRAFTSQASATMHLPAT
IGDYTDFYSSRQHATNVGIMFRGKENALLPNWLHLPVGYHGRASSIVVSGTPIRRPMGQM
RPDNSKPPVYGACRLLDMELEMAFFVGPGNRFGEPIPISKAHEHIFGMVLMNDWSARDIQ
QWEYVPLGPFLGKSFGTTISPWVVPMDALMPFVVPNPKQDPKPLPYLCHSQPYTFDINLS
VSLKGEGMSQAATICRSNFKHMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGSDPESFG
SMLELSWKGTKAIDVEQGQTRTFLLDGDEVIITGHCQGDGYRVGFGQCAGKVLPALSPA
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgtcctttattccagtggccgaggactccgactttcccatccaaaacctgccctatggt
gttttctccactcaaagcaacccaaagccacggattggtgtagccatcggtgaccagatc
ttggacctgagtgtcattaaacacctctttaccggacctgccctttccaaacatcaacat
gtcttcgatgagacaactctcaataacttcatgggtctgggtcaagctgcatggaaggag
gcaagagcatccttacagaacttactgtctgccagccaagcccggctcagagatgacaag
gagcttcggcagcgtgcattcacctcccaggcttctgcgacaatgcaccttcctgctacc
ataggagactacacggacttctactcttctcggcagcatgccaccaatgttggcattatg
ttcagaggcaaggagaatgcgctgttgccaaattggctccacttacctgtgggataccat
ggccgagcttcctccattgtggtatctggaaccccgattcgaagacccatggggcagatg
agacctgataactcaaagcctcctgtgtatggtgcctgcagactcttagacatggagttg
gaaatggctttcttcgtaggccctgggaacagattcggagagccaatccccatttccaaa
gcccatgaacacattttcgggatggtcctcatgaacgactggagcgcacgagacatccag
caatgggagtacgtcccacttgggccattcctggggaaaagctttggaaccacaatctcc
ccgtgggtggtgcctatggatgccctcatgccctttgtggtgccaaacccaaagcaggac
cccaagcccttgccatatctctgccacagccagccctacacatttgatatcaacctgtct
gtctctttgaaaggagaaggaatgagccaggcggctaccatctgcaggtctaactttaag
cacatgtactggaccatgctgcagcaactcacacaccactctgttaatggatgcaacctg
agacctggggacctcttggcttctggaaccatcagtggatcagaccctgaaagctttggc
tccatgctggaactgtcctggaagggaacaaaggccatcgatgtggagcaggggcagacc
aggaccttcctgctggacggcgatgaagtcatcataacaggtcactgccagggggacggc
taccgtgttggctttggccagtgtgctgggaaagtgctgcctgccctttcaccagcctga

DBGET integrated database retrieval system