KEGG   Mus musculus (mouse): 140859
Entry
140859            CDS       T01002                                 

Gene name
Nek8, 4632401F23Rik, b2b1449Clo, jck
Definition
(RefSeq) NIMA (never in mitosis gene a)-related expressed kinase 8
  KO
K20877  NIMA (never in mitosis gene a)-related kinase 8 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    140859 (Nek8)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    140859 (Nek8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     140859 (Nek8)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  NEK family
   140859 (Nek8)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    140859 (Nek8)
SSDB
Motif
Pfam: Pkinase RCC1 PK_Tyr_Ser-Thr RCC1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 140859
NCBI-ProteinID: NP_543125
MGI: 1890646
Ensembl: ENSMUSG00000017405
Vega: OTTMUSG00000000109
UniProt: Q91ZR4
Position
11 B5; 11 46.74 cM
AA seq 698 aa
MEKYERIRVVGRGAFGIVHLCLRKADQKLVILKQIPVEQMTKEERQAAQNECQVLKLLNH
PNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVH
THLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPY
NQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLS
LEPAQRPPLSHIMAQPLCIRALLNIHTDVGSVRMRRAEKSLTPGPPIASGSTGSRATSAR
CRGVPRGPVRPAIPPPLSSVYAWGGGLSSPLRLPMLNTEVVQVAAGRTQKAGVTRSGRLI
LWEAPPLGAGGGTLLPGAVELPQPQFVSRFLEGQSGVTIKHVACGDLFTACLTDRGIIMT
FGSGSNGCLGHGNLTDISQPTIVEALLGYEMVQVACGASHVLALSTDGELFAWGRGDGGR
LGLGTRESHNCPQQVPVAPGQEAQRVVCGIDSSMILTSPGRVLACGSNRFNKLGLDHLSL
DEEPVPYQQVEEALSFTPLGSAPLDQEPLLCVDLGTAHSAAITASGDCYTFGSNQHGQLG
TSSRRVSRAPCRVQGLEGIKMVMVACGDAFTVAVGAEGEVYSWGKGTRGRLGRRDEDAGL
PRPVQLDETHPYMVTSVSCCHGNTLLAVRSVTDEPVPP
NT seq 2097 nt   +upstreamnt  +downstreamnt
atggagaagtacgagcggatccgagtggtgggaagaggtgccttcgggattgtgcacctg
tgcctgcgaaaggccgaccagaagctggtgatcctcaagcagatcccagtggaacagatg
accaaagaagagaggcaggcggcccagaacgagtgccaggtgctcaagctgctcaaccac
cccaacgtcatcgagtactatgagaatttcctagaggacaaggccctcatgattgctatg
gagtacgcaccaggtggcaccttggccgagttcatccagaagcgctgcaactctctgcta
gaggaggagacgatccttcacttctttgtgcagatcctgctggctctgcatcacgtgcac
acacatctcatcctgcatcgggacctcaagacacagaacatccttcttgacaaacaccgc
atggtggtcaagatcggtgactttggcatctctaagatcctcagcagcaagagcaaggcc
tacacggtggtgggtacaccctgctacatctcccctgagctgtgtgagggcaaaccctac
aaccagaagagtgacatctgggctctgggctgtgtcttatatgagctggccagcctcaag
agggccttcgaggctgcaaacttgccagccctggtgctgaagatcatgagtggcaccttc
gcacccatctctgaccggtacagccctgagcttcgccagctcgtcctgagtctgcttagc
ctggaacctgcacagaggccacccctcagccacatcatggcgcagcccctctgcatccgg
gccctactcaacatccacaccgatgtgggcagcgtgcgcatgcggagggcagagaagtcc
ctgaccccaggaccacctatagcctctggcagcacagggagcagggccaccagtgcccga
tgtaggggtgtcccccggggacctgtgagaccggctatcccaccgccactgtcttcggtc
tacgcttggggtggtggccttagcagtcccctgaggttgccaatgctcaacacggaggtg
gtccaggtagccgctgggcgcacgcagaaggctggcgttacgcgctctggacgcctcatc
ctgtgggaggccccacccctgggagctggaggcggcacactccttcctggagccgtggag
ctgcctcagccccagtttgtctctcgtttcctggaaggccagtcaggtgtgaccatcaag
catgtggcctgcggggacctgttcaccgcttgcttgacagaccgaggcattatcatgacg
ttcggcagtggcagcaatgggtgtttaggtcacggcaacctgactgacatcagccagccc
accattgtagaagccttgctgggctatgagatggtgcaggtggcctgtggggcctctcat
gtgctggccctgtccacagatggagagttattcgcctggggcagaggagatggtggtaga
ctgggactaggcaccagggagtcccataactgccctcagcaggtgcctgtggccccagga
caggaagctcagagagttgtctgtggtattgactcttccatgatcctcacctctccaggc
agggtcctggcctgtggaagtaacaggttcaacaagctaggcttggaccacctatccctg
gacgaggagcctgttccctaccagcaagtggaggaggccctgagcttcacaccactgggc
tctgcacctctggaccaggagcccctgctgtgtgtggaccttggcactgctcattcagct
gctatcactgcttctggggactgctatacttttggcagcaatcaacatggacagctgggc
accagttcccgcagggtcagcagggcaccctgtcgggtccaaggcctggagggcatcaag
atggtgatggtggcctgcggggatgccttcactgtggccgttggggcagagggggaagtg
tattcttggggcaaaggaacccgaggccgactgggaaggagggatgaggatgcggggctg
cctaggccagtgcagctggatgagactcatccttacatggtgacttcagtgtcctgctgc
catgggaacactctgctggctgttcgatcagtcacagatgaaccagttcccccctga

DBGET integrated database retrieval system