KEGG   Mus musculus (mouse): 140904Help
Entry
140904            CDS       T01002                                 

Gene name
Caln1, 9630012C17Rik, Cabp8, MNCb-0849
Definition
(RefSeq) calneuron 1
  KO
K23849   
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF1796 EFhand_Ca_insen
Motif
Other DBs
NCBI-GeneID: 140904
NCBI-ProteinID: NP_067346
MGI: 2155987
Ensembl: ENSMUSG00000060371
Vega: OTTMUSG00000023954
UniProt: Q9JJG7 Q542R1
Position
5; 5 G1.3-G2
AA seq 219 aa AA seqDB search
MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQE
LGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTID
SIFWQFDMQRVTLEELKHILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHS
QKQNRQTCVRKSLICAFAMAFIISVMLIAANQILRSGME
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgccgttccaccatgtaaccgctggcttgttgtacaaggggaattacctcaaccgatct
ctgtctgcaggcagtgacagcgagcagttggctaatatctccgtggaagaactggatgaa
atccgagaagccttccgtgttctggacagagatggcaacggcttcatctccaagcaggag
ctgggcatggccatgcgctccttggggtacatgccgagcgaagtggagctggctatcatc
atgcagcgtttggacatggacggagatgggcaggtagattttgatgaattcatgacgatt
cttgggcccaagctggtgtcatcagaaggtcgggatggttttcttggaaatacgatagac
agtatcttctggcagttcgacatgcagagagtcacgctggaagagctgaagcacatcctg
taccacgccttccgggatcacttaacgatgaaggacattgagaacattatcatcaacgag
gaggagagtttgaacgagacctcggggaactgccagacagagtttgaaggagttcattcg
cagaaacagaaccgacagacctgcgtccgcaagagcctcatatgcgcctttgccatggcc
ttcatcataagcgtcatgctgatcgcagccaaccagatcctgcggagcggcatggagtag

DBGET integrated database retrieval system