KEGG   Mus musculus (mouse): 14102Help
Entry
14102             CDS       T01002                                 

Gene name
Fas, AI196731, APO1, APT1, CD95, TNFR6, Tnfrsf6, lpr
Definition
(RefSeq) Fas (TNF receptor superfamily member 6)
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04650  Natural killer cell mediated cytotoxicity
mmu04668  TNF signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04940  Type I diabetes mellitus
mmu05010  Alzheimer's disease
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    14102 (Fas)
   04668 TNF signaling pathway
    14102 (Fas)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14102 (Fas)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    14102 (Fas)
   04217 Necroptosis
    14102 (Fas)
   04115 p53 signaling pathway
    14102 (Fas)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    14102 (Fas)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14102 (Fas)
   05205 Proteoglycans in cancer
    14102 (Fas)
  Immune diseases
   05320 Autoimmune thyroid disease
    14102 (Fas)
   05330 Allograft rejection
    14102 (Fas)
   05332 Graft-versus-host disease
    14102 (Fas)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    14102 (Fas)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    14102 (Fas)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    14102 (Fas)
  Infectious diseases
   05162 Measles
    14102 (Fas)
   05164 Influenza A
    14102 (Fas)
   05161 Hepatitis B
    14102 (Fas)
   05168 Herpes simplex infection
    14102 (Fas)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    14102 (Fas)
   05165 Human papillomavirus infection
    14102 (Fas)
   05142 Chagas disease (American trypanosomiasis)
    14102 (Fas)
   05143 African trypanosomiasis
    14102 (Fas)
  Drug resistance
   01524 Platinum drug resistance
    14102 (Fas)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   14102 (Fas)
CD molecules [BR:mmu04090]
 Proteins
  14102 (Fas)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TNFR_c6
Motif
Other DBs
NCBI-GeneID: 14102
NCBI-ProteinID: NP_032013
MGI: 95484
Ensembl: ENSMUSG00000024778
UniProt: P25446
Structure
PDB: 

Position
19 C1; 19 29.48 cM
AA seq 327 aa AA seqDB search
MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQ
PGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQN
TKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLI
PLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKF
ARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLD
KFQDMVQKDLGKSTPDTGNENEGQCLE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggatctgggctgtcctgcctctggtgcttgctggctcacagttaagagttcat
actcaaggtactaatagcatctccgagagtttaaagctgaggaggcgggttcgtgaaact
gataaaaactgctcagaaggattatatcaaggaggcccattttgctgtcaaccatgccaa
cctggtaaaaaaaaagttgaggactgcaaaatgaatgggggtacaccaacctgcgcccca
tgcacagaagggaaggagtacatggacaagaaccattatgctgataaatgcagaagatgc
acactctgcgatgaagagcatggtttagaggtggaaacaaactgcaccctgacccagaat
accaagtgcaagtgcaaaccagacttctactgcgattctcctggctgtgaacactgtgtt
cgctgcgcctcgtgtgaacatggaacccttgagccgtgcacagcaaccagcaatacaaac
tgcaggaaacaaagtcccagaaatcgcctatggttgttgaccatccttgttttgttaatt
ccacttgtatttatatatcgaaagtaccggaaaagaaagtgctggaaaaggagacaggat
gaccctgaatctagaacctccagtcgtgaaaccataccaatgaatgcctcaaatcttagc
ttgagtaaatacatcccgagaattgctgaagacatgacaatccaggaagctaaaaaattt
gctcgagaaaataacatcaaggagggcaagatagatgagatcatgcatgacagcatccaa
gacacagctgagcagaaagtccagctgctcctgtgctggtaccaatctcatgggaagagt
gatgcatatcaagatttaatcaagggtctcaaaaaagccgaatgtcgcagaaccttagat
aaatttcaggacatggtccagaaggaccttggaaaatcaaccccagacactggaaatgaa
aatgaaggacaatgtctggagtga

DBGET integrated database retrieval system