KEGG   Mus musculus (mouse): 14102
Entry
14102             CDS       T01002                                 

Gene name
Fas, AI196731, AP, APO1, APT1, CD95, TNF, TNFR6, Tnfr, Tnfrsf6, lpr
Definition
(RefSeq) Fas (TNF receptor superfamily member 6)
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04650  Natural killer cell mediated cytotoxicity
mmu04668  TNF signaling pathway
mmu04932  Non-alcoholic fatty liver disease
mmu04940  Type I diabetes mellitus
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05142  Chagas disease
mmu05143  African trypanosomiasis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14102 (Fas)
   04668 TNF signaling pathway
    14102 (Fas)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14102 (Fas)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    14102 (Fas)
   04217 Necroptosis
    14102 (Fas)
   04115 p53 signaling pathway
    14102 (Fas)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14102 (Fas)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14102 (Fas)
   05205 Proteoglycans in cancer
    14102 (Fas)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14102 (Fas)
   05161 Hepatitis B
    14102 (Fas)
   05160 Hepatitis C
    14102 (Fas)
   05164 Influenza A
    14102 (Fas)
   05162 Measles
    14102 (Fas)
   05168 Herpes simplex virus 1 infection
    14102 (Fas)
   05163 Human cytomegalovirus infection
    14102 (Fas)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14102 (Fas)
   05169 Epstein-Barr virus infection
    14102 (Fas)
   05165 Human papillomavirus infection
    14102 (Fas)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    14102 (Fas)
   05143 African trypanosomiasis
    14102 (Fas)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14102 (Fas)
   05330 Allograft rejection
    14102 (Fas)
   05332 Graft-versus-host disease
    14102 (Fas)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    14102 (Fas)
   05022 Pathways of neurodegeneration - multiple diseases
    14102 (Fas)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14102 (Fas)
   04932 Non-alcoholic fatty liver disease
    14102 (Fas)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14102 (Fas)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    14102 (Fas)
   04090 CD molecules [BR:mmu04090]
    14102 (Fas)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   14102 (Fas)
CD molecules [BR:mmu04090]
 Proteins
  14102 (Fas)
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 14102
NCBI-ProteinID: NP_032013
MGI: 95484
Ensembl: ENSMUSG00000024778
UniProt: P25446
Structure
PDB: 
3OQ9 2NA6

Position
19 C1; 19 29.48 cM
AA seq 327 aa
MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQ
PGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQN
TKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLI
PLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKF
ARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLD
KFQDMVQKDLGKSTPDTGNENEGQCLE
NT seq 984 nt   +upstreamnt  +downstreamnt
atgctgtggatctgggctgtcctgcctctggtgcttgctggctcacagttaagagttcat
actcaaggtactaatagcatctccgagagtttaaagctgaggaggcgggttcgtgaaact
gataaaaactgctcagaaggattatatcaaggaggcccattttgctgtcaaccatgccaa
cctggtaaaaaaaaagttgaggactgcaaaatgaatgggggtacaccaacctgcgcccca
tgcacagaagggaaggagtacatggacaagaaccattatgctgataaatgcagaagatgc
acactctgcgatgaagagcatggtttagaggtggaaacaaactgcaccctgacccagaat
accaagtgcaagtgcaaaccagacttctactgcgattctcctggctgtgaacactgtgtt
cgctgcgcctcgtgtgaacatggaacccttgagccgtgcacagcaaccagcaatacaaac
tgcaggaaacaaagtcccagaaatcgcctatggttgttgaccatccttgttttgttaatt
ccacttgtatttatatatcgaaagtaccggaaaagaaagtgctggaaaaggagacaggat
gaccctgaatctagaacctccagtcgtgaaaccataccaatgaatgcctcaaatcttagc
ttgagtaaatacatcccgagaattgctgaagacatgacaatccaggaagctaaaaaattt
gctcgagaaaataacatcaaggagggcaagatagatgagatcatgcatgacagcatccaa
gacacagctgagcagaaagtccagctgctcctgtgctggtaccaatctcatgggaagagt
gatgcatatcaagatttaatcaagggtctcaaaaaagccgaatgtcgcagaaccttagat
aaatttcaggacatggtccagaaggaccttggaaaatcaaccccagacactggaaatgaa
aatgaaggacaatgtctggagtga

KEGG   Mus musculus (mouse): 21937
Entry
21937             CDS       T01002                                 

Gene name
Tnfrsf1a, CD120, CD120a, FPF, TN, TNF-, TNF-R, TNF-R-I, TNF-R1, TNF-R55, TNF-a, TNF-alphaR1, TNFAR, TNFR, TNFR60, TNFRI, TNFRp55, TNFal, TNFalpha-R1, Tnf, Tnfr-2, Tnfr1, p5, p55, p55-R
Definition
(RefSeq) tumor necrosis factor receptor superfamily, member 1a
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04064  NF-kappa B signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04150  mTOR signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04668  TNF signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    21937 (Tnfrsf1a)
   04064 NF-kappa B signaling pathway
    21937 (Tnfrsf1a)
   04668 TNF signaling pathway
    21937 (Tnfrsf1a)
   04071 Sphingolipid signaling pathway
    21937 (Tnfrsf1a)
   04150 mTOR signaling pathway
    21937 (Tnfrsf1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21937 (Tnfrsf1a)
   04061 Viral protein interaction with cytokine and cytokine receptor
    21937 (Tnfrsf1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    21937 (Tnfrsf1a)
   04215 Apoptosis - multiple species
    21937 (Tnfrsf1a)
   04217 Necroptosis
    21937 (Tnfrsf1a)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    21937 (Tnfrsf1a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    21937 (Tnfrsf1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    21937 (Tnfrsf1a)
   05170 Human immunodeficiency virus 1 infection
    21937 (Tnfrsf1a)
   05160 Hepatitis C
    21937 (Tnfrsf1a)
   05171 Coronavirus disease - COVID-19
    21937 (Tnfrsf1a)
   05164 Influenza A
    21937 (Tnfrsf1a)
   05168 Herpes simplex virus 1 infection
    21937 (Tnfrsf1a)
   05163 Human cytomegalovirus infection
    21937 (Tnfrsf1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    21937 (Tnfrsf1a)
   05165 Human papillomavirus infection
    21937 (Tnfrsf1a)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    21937 (Tnfrsf1a)
   05152 Tuberculosis
    21937 (Tnfrsf1a)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    21937 (Tnfrsf1a)
   05142 Chagas disease
    21937 (Tnfrsf1a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    21937 (Tnfrsf1a)
   05014 Amyotrophic lateral sclerosis
    21937 (Tnfrsf1a)
   05022 Pathways of neurodegeneration - multiple diseases
    21937 (Tnfrsf1a)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    21937 (Tnfrsf1a)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    21937 (Tnfrsf1a)
   04931 Insulin resistance
    21937 (Tnfrsf1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    21937 (Tnfrsf1a)
   04090 CD molecules [BR:mmu04090]
    21937 (Tnfrsf1a)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   21937 (Tnfrsf1a)
CD molecules [BR:mmu04090]
 Proteins
  21937 (Tnfrsf1a)
SSDB
Motif
Pfam: TNFR_c6 Death DUF4880
Other DBs
NCBI-GeneID: 21937
NCBI-ProteinID: NP_035739
MGI: 1314884
Ensembl: ENSMUSG00000030341
Vega: OTTMUSG00000023806
UniProt: P25118 Q3U479
Position
6 F3; 6 59.32 cM
AA seq 454 aa
MGLPTVPGLLLSLVLLALLMGIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCT
KCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQAD
KDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECV
PCSHCKKNEECMKLCLPPPLANVTNPQDSGTAVLLPLVILLGLCLLSFIFISLMCRYPRW
RPEVYSIICRDPVPVKEEKAGKPLTPAPSPAFSPTSGFNPTLGFSTPGFSSPVSSTPISP
IFGPSNWHFMPPVSEVVPTQGADPLLYESLCSVPAPTSVQKWEDSAHPQRPDNADLAILY
AVVDGVPPARWKEFMRFMGLSEHEIERLEMQNGRCLREAQYSMLEAWRRRTPRHEDTLEV
VGLVLSKMNLAGCLENILEALRNPAPSSTTRLPR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgggtctccccaccgtgcctggcctgctgctgtcactggtgctcctggctctgctgatg
gggatacatccatcaggggtcactggactagtcccttctcttggtgaccgggagaagagg
gatagcttgtgtccccaaggaaagtatgtccattctaagaacaattccatctgctgcacc
aagtgccacaaaggaacctacttggtgagtgactgtccgagcccagggcgggatacagtc
tgcagggagtgtgaaaagggcacctttacggcttcccagaattacctcaggcagtgtctc
agttgcaagacatgtcggaaagaaatgtcccaggtggagatctctccttgccaagctgac
aaggacacggtgtgtggctgtaaggagaaccagttccaacgctacctgagtgagacacac
ttccagtgcgtggactgcagcccctgcttcaacggcaccgtgacaatcccctgtaaggag
actcagaacaccgtgtgtaactgccatgcagggttctttctgagagaaagtgagtgcgtc
ccttgcagccactgcaagaaaaatgaggagtgtatgaagttgtgcctacctcctccgctt
gcaaatgtcacaaacccccaggactcaggtactgcggtgctgttgcccctggttatcttg
ctaggtctttgccttctatcctttatcttcatcagtttaatgtgccgatatccccggtgg
aggcccgaagtctactccatcatttgtagggatcccgtgcctgtcaaagaggagaaggct
ggaaagcccctaactccagccccctccccagccttcagccccacctccggcttcaacccc
actctgggcttcagcaccccaggctttagttctcctgtctccagtacccccatcagcccc
atcttcggtcctagtaactggcacttcatgccacctgtcagtgaggtagtcccaacccag
ggagctgaccctctgctctacgaatcactctgctccgtgccagcccccacctctgttcag
aaatgggaagactccgcccacccgcaacgtcctgacaatgcagaccttgcgattctgtat
gctgtggtggatggcgtgcctccagcgcgctggaaggagttcatgcgtttcatggggctg
agcgagcacgagatcgagaggctggagatgcagaacgggcgctgcctgcgcgaggctcag
tacagcatgctggaagcctggcggcgccgcacgccgcgccacgaggacacgctggaagta
gtgggcctcgtgctttccaagatgaacctggctgggtgcctggagaatatcctcgaggct
ctgagaaatcccgccccctcgtccacgacccgcctcccgcgataa

DBGET integrated database retrieval system