KEGG   Mus musculus (mouse): 14104
Entry
14104             CDS       T01002                                 

Gene name
Fasn, A630082H08Rik, F, FAS
Definition
(RefSeq) fatty acid synthase
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
Module
mmu_M00082  Fatty acid biosynthesis, initiation
mmu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    14104 (Fasn)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    14104 (Fasn)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    14104 (Fasn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    14104 (Fasn)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14104 (Fasn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     14104 (Fasn)
Lipid biosynthesis proteins [BR:mmu01004]
 Fatty acid synthase
  Animal type
   14104 (Fasn)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14104 (Fasn)
  Exosomal proteins of breast milk
   14104 (Fasn)
  Exosomal proteins of colorectal cancer cells
   14104 (Fasn)
  Exosomal proteins of bladder cancer cells
   14104 (Fasn)
SSDB
Motif
Pfam: Acyl_transf_1 ketoacyl-synt Thioesterase KR KAsynt_C_assoc Ketoacyl-synt_C PS-DH ADH_zinc_N ADH_zinc_N_2 PP-binding Methyltransf_12 adh_short Methyltransf_31 Thiolase_N Methyltransf_11 Methyltransf_23 adh_short_C2 YjeF_N ACP_syn_III
Other DBs
NCBI-GeneID: 14104
NCBI-ProteinID: NP_032014
MGI: 95485
Ensembl: ENSMUSG00000025153
Vega: OTTMUSG00000004143
UniProt: P19096
Structure
PDB: 
5MY2 5MY0

Position
11 E2; 11 84.56 cM
AA seq 2504 aa
MEEVVIAGMSGKLPESENLQEFWANLIGGVDMVTDDDRRWKAGLYGLPKRSGKLKDLSKF
DASFFGVHPKQAHTMDPQLRLLLEVSYEAIVDGGINPASLRGTNTGVWVGVSGSEASEAL
SRDPETLLGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSLLALQNAYQAIRSGEC
PAALVGGINLLLKPNTSVQFMKLGMLSPDGTCRSFDDSGSGYCRSEAVVAVLLTKKSLAR
RVYATILNAGTNTDGSKEQGVTFPSGEVQEQLICSLYQPAGLAPESLEYIEAHGTGTKVG
DPQELNGITRSLCAFRQAPLLIGSTKSNMGHPEPASGLAALTKVLLSLEHGVWAPNLHFH
NPNPEIPALLDGRLQVVDRPLPVRGGNVGINSFGFGGSNVHVILQPNTRQAPAPTAHAAL
PHLLHASGRTLEAVQDLLEQGRQHSQDLAFVSMLNDIAATPTAAMPFRGYTVLGVEGRVQ
EVQQVSTNKRPLWFICSGMGTQWRGMGLSLMRLDSFRESILRSDEAVKPLGVKVSDLLLS
TDERTFDDIVHAFVSLTAIQIALIDLLTSVGLKPDGIIGHSLGEVACGYADGCLSQREAV
LAAYWRGQCIKDAHLPPGSMAAVGLSWEECKQRCPAGVVPACHNSEDTVTISGPQAAVNE
FVEQLKQEGVFAKEVRTGGLAFHSYFMEGIAPTLLQALKKVIREPRPRSARWLSTSIPEA
QWQSSLARTSSAEYNVNNLVSPVLFQEALWHIPEHAVVLEIAPHALLQAVLKRGVKSSCT
IIPLMKRDHKDNLEFFLTNLGKVHLTGINVNPNALFPPVEFPAPRGTPLISPHIKWDHSQ
TWDVPVAEDFPNGSSSSSATVYSIDASPESPDHYLVDHCIDGRVIFPGTGYLCLVWKTLA
RSLGLSLEETPVVFENVSFHQATILPKTGTVALEVRLLEASHAFEVSDTGNLIVSGKVYL
WEDPNSKLFDHPEVPTPPESASVSRLTQGEVYKELRLRGYDYGPQFQGICEATLEGEQGK
LLWKDNWVTFMDTMLQVSILGSSQQSLQLPTRVTAIYIDPATHRQKVYRLKEDTQVADVT
TSRCLGITVSGGIHISRLQTTATSRRQQEQLVPTLEKFVFTPHMEAECLSESTALQKELQ
LCKGLARALQTKATQQGLKAAMLGQEDPPQHGLPRLLAAACQLQLNGNLQLELGEALAQE
RLLLPEDPLISGLLNSQALKACVDTALENLSTLKMKVAEVLAGEGHLYSRIPALLNTQPM
LQLEYTATDRHPQALKDVQTKLQQHDVAQGQWNPSDPAPSSLGALDLLVCNCALATLGDP
ALALDNMVAALKEGGFLLVHTVLKGHALGETLACLPSEVQPAPSLLSQEEWESLFSRKAL
HLVGLKRSFYGTALFLCRRAIPQEKPIFLSVEDTSFQWVDSLKSTLATSSSQPVWLTAMD
CPTSGVVGLVNCLRKEPGGHRIRCILLSNLSNTSHAPKLDPGSPELQQVLKHDLVMNVYR
DGAWGAFRHFQLEQDKPKEQTAHAFVNVLTRGDLASIRWVSSPLKHTQPSSSGAQLCTVY
YASLNFRDIMLATGKLSPDAIPGKWASRDCMLGMEFSGRDRCGRRVMGLVPAEGLATSVL
LSSDFLWDVPSSWTLEEAASVPVVYTTAYYSLVVRGRIQRGETVLIHSGSGGVGQAAISI
ALSLGCRVFTTVGSAEKRAYLQARFPQLDDTSFANSRDTSFEQHVLLHTGGKGVDLVLNS
LAEEKLQASVRCLAQHGRFLEIGKFDLSNNHPLGMAIFLKNVTFHGILLDALFEEANDSW
REVAALLKAGIRDGVVKPLKCTVFPKAQVEDAFRYMAQGKHIGKVLVQVREEEPEAVLPG
AQPTLISAISKTFCPAHKSYIITGGLGGFGLELARWLVLRGAQRLVLTSRSGIRTGYQAK
HIREWRRQGIQVLVSTSNVSSLEGARALIAEATKLGPVGGVFNLAMVLRDAMLENQTPEL
FQDVNKPKYNGTLNLDRATREACPELDYFVAFSSVSCGRGNAGQTNYGFANSTMERICEQ
RRHDGLPGLAVQWGAIGDVGIVLEAMGTNDTVIGGTLPQRISSCMEVLDLFLNQPHAVLS
SFVLAEKKAVAHGDGDTQRDLVKAVAHILGIRDLAGINLDSTLADLGLDSLMGVEVRQIL
EREHDLVLPMREVRQLTLRKLQEMSSKTDSATDTTAPKSRSDTSLKQNQLNLSTLLVNPE
GPTLTQLNSVQSSERPLFLVHPIEGSTTVFHSLAAKLSVPTYGLQCTQAAPLDSIPNLAA
YYIDCIKQVQPEGPYRIAGYSFGACVAFEMCSQLQAQQGPAPTHNNLFLFDGSHTYVLAY
TQSYRAKMTPGCEAEAEAEALCFFIKQFLDVEHSKVLEALLPLKSLEDRVAASVDLITKS
HHSLDRRELSFAAVSFYHKLRAADQYKPKAKYHGNVTLLRAKTGGTYGEDLGADYNLSQV
CDGKVSVHIIEGDHRTLLEGSGLESIINIIHSSLAEPRVSVREG
NT seq 7515 nt   +upstreamnt  +downstreamnt
atggaggaggtggtgatagccggtatgtcggggaagttgcccgagtcagagaacctacag
gagttctgggccaacctcattggtggtgtggacatggtcacagatgatgacaggagatgg
aaggctgggctctatggattacccaagcggtctggaaagctgaaggatctctccaagttc
gacgcctccttttttggggtccaccccaagcaggcacacacaatggacccccagcttcgg
ctgctgttggaagtcagctatgaagcaattgtggatggaggtatcaacccagcctcactc
cgaggaacgaacactggcgtctgggtgggtgtgagtggttcagaggcatccgaggccctt
agcagagatcccgagacgcttctgggctacagcatggtgggctgccagcgtgcaatgatg
gccaaccggctctctttcttcttcgacttcaaaggaccaagcattgccctggacacagcc
tgctcctccagcttgctggcactacagaatgcctaccaggccatccgtagtggggaatgc
cccgcggcccttgtgggtgggatcaacctgctcctgaagccgaacacctctgtgcagttc
atgaagctgggcatgctcagcccggacggcacctgcagatcctttgatgattcagggagt
ggatattgtcgctctgaggctgttgtagcagttctgctgactaagaagtccctggctcgg
cgggtctatgccacgattctgaatgccggcaccaatacagatggcagcaaggagcaaggt
gtaacattcccctctggagaagtccaagaacaactcatctgctctctgtatcagccagct
ggtctggccccggagtcgcttgagtatattgaagcccatggcacgggcaccaaggtgggt
gacccccaggaactgaatggcattactcggtccctgtgcgccttccgccaggcccctctg
ttaattggctccaccaaatccaacatgggacaccctgagcctgcctctgggcttgcagcc
ctgaccaaggtgctgttatccctggagcatggggtctgggcccctaacctgcacttccac
aaccccaaccctgagatcccagcacttcttgatgggcggctgcaggtggtcgataggccc
ctgcctgttcgtggtggcaacgtgggcatcaactcatttggcttcggaggctccaatgtt
catgtcatcctccagcccaacacacggcaggcccctgcgcccactgcacacgctgccctt
ccccatttgctgcacgccagtggacgcaccttagaggcagtgcaggacctgctggaacag
ggccgccagcacagccaggacctggcctttgtgagcatgctcaatgacattgcggcaacc
cctacagcagccatgcccttcaggggttacactgtgctaggtgttgagggccgtgtccaa
gaagtgcagcaagtgtccaccaacaagcgcccactctggttcatctgctcagggatgggc
acgcagtggcgcgggatggggctgagcctcatgcgcctggacagcttccgtgagtctatc
ctgcgctccgatgaggctgtgaagccgttgggagtgaaagtgtcagatctgctgttgagc
acagatgagcgcacctttgatgacatcgtgcatgcctttgtgagcctcactgccatccag
attgccctcatcgacctactgacttctgtgggactgaaacctgacggcatcattgggcac
tccttgggagaggttgcctgtggctatgcagatggctgtctctcccagagagaggctgtg
cttgcagcttactggcgaggccagtgcatcaaagatgcccacctcccgcctggatccatg
gcagctgttggtttgtcctgggaggaatgtaaacagcgctgccccgctggcgtggtgcct
gcctgccacaactctgaggacaccgtgaccatctctggacctcaggctgcagtgaatgaa
tttgtggagcagctaaagcaagaaggtgtgtttgccaaggaggtacgaacaggaggcctg
gctttccactcctacttcatggaaggaattgcccccacattgctgcaggctctcaagaag
gtgatccgggaaccacggccgcgctcggctcgatggctcagcacctctatccctgaggcc
cagtggcagagcagcctggcccgcacatcttctgccgagtacaatgtcaacaacctggtg
agccctgtgctcttccaggaagcactgtggcacatccctgagcatgccgtggtgctggag
attgcgccccacgcactgttgcaggctgtcctgaagcgaggcgtgaagtccagctgcacc
atcattcccttgatgaagagggatcataaagataacttggagttctttctcaccaacctt
ggcaaggtgcacctcacaggcatcaatgtcaaccctaacgccttgttcccacctgtggag
ttcccggctccccgagggactcctctcatctcccctcacatcaagtgggaccacagtcag
acttgggatgtcccggttgctgaggacttcccaaacggctccagctcctcctctgctaca
gtctacagcatcgacgccagtcctgagtcgcccgaccactacctggtagaccactgcatt
gacggccgggtcatcttccctggcactggctacctgtgcctggtgtggaagacactggct
cgcagcctgggcttgtccctagaagagacccctgtggtatttgagaatgtgtcgtttcat
caggccactatactacccaagacaggaaccgtggcgctggaggtgaggctgctagaggcc
tcccatgcctttgaggtgtctgacactggcaatctgattgtgagcggaaaagtgtacctg
tgggaagacccgaactccaagttattcgaccacccagaagtcccaacaccccctgagtct
gcatcggtctcccgcctgacccagggagaagtatacaaggagctgcggctgcgtggctat
gattatggccctcagttccagggcatctgtgaggccacccttgaaggtgaacaaggcaag
ctgctctggaaagataactgggtgaccttcatggacacaatgctgcaggtatccattctg
ggttctagccagcagagtctacagctacctacccgtgtgaccgccatctatatcgaccct
gccacccaccgtcagaaggtgtacaggctgaaggaggacactcaagtggctgatgtgaca
acgagccgctgtctgggcataacggtctctggtggtatccacatctcaagactacagacg
acagcaacctcacggcggcagcaagaacagctggtccccaccttggaaaagttcgttttc
acaccgcacatggaggctgagtgcctgtctgagagcactgccctgcagaaggagctgcaa
ctgtgcaagggtctggcacgggctctgcagaccaaggccacccagcaagggctgaaggcg
gcaatgcttgggcaagaggaccctccacagcacgggctgcctcgactcctggcagctgct
tgccagttgcagctcaacgggaacctgcagctggagctgggagaagcgctggctcaagag
aggctcctgctgccagaagaccctctgatcagtggcctcctcaactcccaggccctcaag
gcctgcgtagacacagccctggagaacttgtctactctcaagatgaaggtggcagaggtg
ctggctggagaaggccacttgtattcccgaatcccggcactgctcaacacccagcccatg
ctacaactggaatacacagccaccgaccggcacccccaggccctgaaggatgttcagacc
aaactgcagcagcatgatgtggcgcagggccagtggaacccttccgaccctgcgcccagc
agcctgggtgcccttgaccttctggtgtgcaactgtgcattagccaccctgggggatcca
gccttggccctggacaacatggtagctgccctcaaggaaggtggtttcctgctagtgcac
acagtgctcaaaggacatgcccttggggagaccctggcctgcctaccctctgaggtgcag
cctgcgcccagcctcctaagccaggaggagtgggagagcctgttctcgaggaaggcacta
cacctggtgggccttaaaaggtccttctacggtactgcgctgttcctgtgccggcgagcc
atcccacaggagaaacctatcttcctgtctgtggaggataccagcttccagtgggtggac
tctctgaagagcactctggccacgtcctcctcccagcctgtgtggctaacggccatggac
tgccccacctcgggtgtggtgggtttggtgaattgtctccgaaaagagccgggtggacac
cggattcggtgtatcctgctgtccaacctcagcaacacatctcacgcccccaagttggac
cctggctctccagagctacagcaggtgctaaagcatgacctcgtgatgaacgtgtaccgg
gacggggcctggggtgccttccgtcacttccagttagagcaggacaagcccaaggagcag
acagcgcatgcctttgtaaacgtcctcacccgaggggacctcgcctccatccgctgggtc
tcctcccccctgaagcacacgcagccctcgagctcaggagcacagctctgcactgtctac
tacgcctcactgaacttccgagacatcatgctggccacgggcaagctgtcccctgatgcc
attccaggtaaatgggccagccgagactgcatgctcggcatggagttctcaggccgggat
aggtgtggccggcgtgtgatggggctggttcctgcagaaggcctggccacctcagtcctg
ctatcatctgacttcctctgggatgtaccctccagctggaccctggaggaggcggcctct
gtgcccgtcgtctataccactgcttactactcgttagtggttcgcgggcgcatccagcgt
ggggagaccgtgctcatccactcaggttcaggtggtgtgggccaagcggccatttccatt
gccctcagtctgggctgccgcgtcttcaccactgtgggctctgcagagaagcgagcatac
ctccaggccaggttccctcagcttgatgacaccagctttgccaactcgagggacacatca
tttgagcagcacgtgttactgcacacaggtggcaaaggggtcgacctggtcctcaactca
ctggcagaagagaagctgcaggccagtgtgcggtgcttggctcagcatggtcgcttctta
gagattggcaaatttgatctttctaacaaccaccctctgggcatggctatcttcttgaag
aacgtcactttccatgggatcctgctggacgccctttttgaggaggccaatgacagctgg
cgggaggtggcggcactcctgaaggctggcattcgtgatggagtcgtgaagcccctcaag
tgcacagtgtttcccaaggcccaggtggaagatgccttccgctacatggctcaggggaaa
cacattggcaaagtccttgtccaggtacgggaggaggagcctgaggctgtgctgccaggg
gctcagcccaccctgatttctgccatctccaagaccttctgcccagcccataagagttac
atcatcactggtggcctaggtggctttggcctggagctggcccggtggctcgtgcttcgc
ggagcccagaggcttgtgctgacttcccgatctggaatccgcaccggctaccaagccaag
cacattcgggagtggagacgccagggcatccaagtgctcgtgtcaacaagcaacgtgagc
tcactggagggggcccgtgctctcatcgccgaagccacaaagctggggcccgttgggggt
gtcttcaacctggccatggttttgagggatgccatgctggagaaccagaccccagagctc
ttccaggatgtcaacaagcccaaatacaatggcaccctgaaccttgacagggcaacccgg
gaagcctgccctgagctggactactttgtggccttctcctctgtaagctgcgggcgtggt
aatgctggccaaactaactacggcttcgccaactctaccatggagcgtatatgtgaacag
cgcaggcacgatggcctcccaggccttgccgtgcagtggggtgccattggtgacgtgggc
attgtcctggaagcgatgggcaccaatgacacagtcatcggaggtacgctgcctcagcgc
atctcctcctgcatggaggtactggacctcttcctgaatcagccccacgcagtcctgagc
agctttgtgctggcagagaagaaagctgtggcccatggggacggggacacccagagggat
ctggtgaaagctgtagcacacatcctaggcatccgagacctcgcaggtattaacctggac
agcacgctggcagacctcggcctggactcgctcatgggtgtggaagttcgtcagatcctg
gaacgagaacacgatctggtgctgcccatgcgtgaggtgcggcagctcacgctgcggaaa
cttcaggaaatgtcctccaagactgactcggctactgacacgacagcccccaagtccagg
agtgacacgtctctgaagcagaaccaactgaacctgagcacactgctggtgaaccctgag
ggtcctaccctaacccagctcaactcggtgcagagctctgagcggcctctgttccttgtg
caccccattgagggttccaccaccgtgttccacagtctggctgccaagctcagtgtgccc
acctacggcctgcagtgcacccaagctgcccccctggatagcattccgaacctggctgcc
tactacatagattgcatcaagcaagtgcagcctgagggaccctaccgcatagctgggtac
tcatttggagcctgtgtagccttcgagatgtgctcccagctgcaggcccagcagggccca
gccccgacccacaacaacctcttcctgtttgacggctcacacacctacgtgttggcctac
acccagagctaccgggcaaagatgaccccaggctgtgaagccgaggccgaggctgaggcc
ttatgcttcttcataaagcagtttcttgatgtggaacacagcaaggtgctggaggccctg
ctgccactgaagagcctggaagatcgggtggctgcctccgtggaccttatcactaagagt
caccacagcctggaccgccgagagctgagctttgctgccgtgtccttctaccacaagctc
cgggcagctgatcagtataagcccaaggccaagtaccatggcaacgtgacactgctgcgt
gccaagacaggcggcacctatggcgaggacttgggtgctgactacaacctctcccaggtg
tgtgacgggaaggtgtctgtgcacatcattgagggtgaccaccgcacactgctggagggc
agtggcctggaatccatcatcaacatcatccatagctccctggctgagccacgagtgagt
gtacgggagggctag

DBGET integrated database retrieval system