KEGG   Mus musculus (mouse): 14113Help
Entry
14113             CDS       T01002                                 

Gene name
Fbl, AL022665, FIB, FLRN, RNU3IP1
Definition
(RefSeq) fibrillarin
  KO
K14563  rRNA 2'-O-methyltransferase fibrillarin [EC:2.1.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    14113 (Fbl)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     14113 (Fbl)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  Sno RNPs
   Box C/D snoRNPs
    14113 (Fbl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrillarin GCD14 PCMT FtsJ Methyltr_RsmB-F
Motif
Other DBs
NCBI-GeneID: 14113
NCBI-ProteinID: NP_032017
MGI: 95486
Ensembl: ENSMUSG00000046865
Vega: OTTMUSG00000058942
UniProt: P35550
Position
7; 7 A3
AA seq 327 aa AA seqDB search
MKPGFSPRGGGFGGRGGFGDRGGRGGGRGGRGGFGGGRGGFGGGGRGRGGGGGGFRGRGG
GGGRGGGFQSGGNRGRGGGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPG
ESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTV
SHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIF
ADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQ
EQLTLEPYERDHAVVVGVYRPPPKVKN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaggtttcagcccccgtgggggtggctttggtggcagaggcggctttggtgac
agaggcggtagaggaggtggaagaggaggccgaggaggctttggcggtggacgaggaggc
tttggcggtggaggtcgaggtcgaggcggagggggtggtggcttcaggggacgaggaggt
ggcggtggccgaggtgggggcttccagtctgggggcaaccggggtcgaggtggtggccgg
ggaggcaagagaggaaaccagtcagggaagaatgtgatggtggagccgcatcgtcatgaa
ggtgtctttatctgtcgcggaaaggaggatgcccttgtcacaaagaatctggtccctgga
gagtctgtgtatggagagaagagagtctctatttcagaaggagatgacaaaattgagtac
agagcctggaaccccttccgctccaagctggcagcagctatcctgggcggcgtagaccag
atccacatcaagccaggagccaaggtgctctaccttggggcagcctcaggcaccaccgtc
tcccacgtctctgatattgtcggcccggatggtctggtctacgcagttgagttctcccac
cgctctggccgtgacctcatcaacttggccaagaagaggactaacattattcctgtaatt
gaagatgctcgacacccacacaaataccgcatgcttatcgcaatggtggatgtcatcttt
gccgatgtggcccagccagaccaaacccgaattgtggccctgaacgcccacaccttcctg
cggaatggaggacactttgtgatttccattaaggccaactgcattgactccactgcgtca
gcagaggctgtgtttgcatctgaagtgaagaagatgcagcaggagaacatgaagccgcag
gagcagctgacgctagagccttatgagcgagaccacgccgtggttgtcggtgtgtacagg
ccacctcccaaggtgaagaactga

DBGET integrated database retrieval system