KEGG   Mus musculus (mouse): 14118
Entry
14118             CDS       T01002                                 

Symbol
Fbn1, AI536462, B430209H23, Fib-, Fib-1, Tsk
Name
(RefSeq) fibrillin 1
  KO
K06825  fibrillin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    14118 (Fbn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14118 (Fbn1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   14118 (Fbn1)
SSDB
Motif
Pfam: EGF_CA cEGF TB EGF FXa_inhibition hEGF EGF_3 Plasmod_Pvs28 Fibrillin_U_N EGF_MSP1_1
Other DBs
NCBI-GeneID: 14118
NCBI-ProteinID: NP_032019
MGI: 95489
Ensembl: ENSMUSG00000027204
Vega: OTTMUSG00000015332
UniProt: Q61554
Position
2 F1; 2 61.38 cM
AA seq 2873 aa
MRRGGLLEVALAFALLLESYTSHGADANLEAGSLKETRANRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQISPSCGSRSIQHCS
IRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERD
YRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIR
TGACQDVDECQAIPGMCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGVCD
GGECTNTVSSYFCKCPPGFYTSPDGTRCVDVRPGYCYTALANGRCSNQLPQSITKMQCCC
DLGRCWSPGVTVAPEMCPIRSTEDFNKLCSVPLVIPGRPEYPPPPIGPLPPVQPVPPGYP
PGPVIPAPRPPPEYPYPSPSREPPRVLPFNVTDYCQLVRYLCQNGRCIPTPGSYRCECNK
GFQLDIRGECIDVDECEKNPCTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDECLQNG
RICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCIC
KPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMR
STCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMT
SAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLCDN
GQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSPESTL
DPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPICGK
GFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETC
FLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKD
ITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISP
DLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRC
ECPPGHQLSPNISACIDINECELSANLCPHGRCVNLIGKYQCACNPGYHPTHDRLFCVDI
DECSIMNGGCETFCTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIP
GEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKT
GCTDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHA
DCKNTMGSYRCLCKDGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPS
ADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCI
SGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVS
KASCCCSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQ
GGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDY
MQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPI
PSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFF
YNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQCNDRNECQEIPN
ICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDACGNGTCRNTIGSFNCRCNH
GFILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECV
LDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKC
LCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCEL
CPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYI
LEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCA
FRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGP
GYQRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGY
CFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMT
NGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFI
CKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQH
HTACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNHRCQ
HGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHVCGGASCHNTLGSYKCMCPTGFQ
YEQFSGGCQDINECGSSQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVSGMGMGRGGPE
PPASSEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASDIQDGSEMEANVSLASWDV
EKPASFAFNISHVNNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFT
KKKPVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH
NT seq 8622 nt   +upstreamnt  +downstreamnt
atgcggcgaggagggctgctggaggtcgcgctggcgttcgccctgctcctcgagtcctac
acgagccatggggcggacgccaatttggaggctgggagcctgaaggagaccagagccaat
cgggccaagagaagaggcggcggaggacacgatgcgctgaaaggacccaatgtctgtgga
tcacgttataatgcatactgttgtcctggatggaaaaccttacctggtggaaatcagtgt
attgttcccatttgccggcattcctgtggggatggattctgctcgaggccaaatatgtgc
acttgcccgtctggtcagatatctccttcctgtggctccagatccatccaacactgcagc
atccgctgtatgaatgggggcagctgcagcgatgaccactgtctgtgccagaaagggtac
atcggcactcactgtggacagcctgtctgtgaaagtggctgtctcaacggagggaggtgt
gtggccccaaatcggtgtgcttgcacgtacggctttactggaccccagtgtgaaagagat
tacagaacaggcccatgttttactgtggtaagcaaccagatgtgccagggacagctcagc
gggattgtctgcaccaaaacactttgctgtgccaccgtgggccgagcctggggccacccc
tgtgagatgtgtcctgcccagcctcacccctgccgccgcggcttcattcccaacatccgc
actggagcttgtcaagatgtggatgaatgtcaggccatcccagggatgtgtcaaggagga
aattgcattaataccgttggatcttttgagtgcaaatgccctgctggacacaaatttaat
gaagtgtcacaaaaatgtgaagatattgacgagtgcagcaccattcctggagtctgcgat
ggcggggaatgtacaaacactgtcagcagctacttctgcaaatgtccccctggtttttac
acctctcctgatggcaccagatgcgtagatgttcgccctggttactgctacacagctctg
gcaaacgggcgctgctctaaccagctgccacagtccataaccaaaatgcagtgctgttgc
gatcttggccggtgctggtctccaggggttactgttgctcccgagatgtgtcccatcagg
tcaactgaggatttcaacaagctgtgctctgtccctctggtaattcccgggagaccagaa
tatcctcccccacccattggcccccttcctccagttcagcccgttcctcctggctatcct
cctgggcctgtgattccagcccctcggccaccgccagaatatccatatccatctccgtct
cgggaaccaccaagggtgctgcctttcaacgttactgactactgtcaactggtccgctat
ctctgtcaaaatgggcgctgcattccaactcccggtagctaccgctgcgagtgcaacaag
ggcttccagctggatatccgtggcgaatgcatcgacgtggatgagtgtgagaagaaccca
tgcactggtggcgagtgcatcaacaaccagggctcctacacctgtcactgcagagctggc
taccagagcacactcaccagaactgagtgcagagacatagatgagtgtcttcagaatggc
cggatctgcaacaatggtcgctgtatcaacacagacggcagcttccactgcgtatgcaat
gcgggctttcatgtcacgcgggacggaaagaactgtgaagatatggatgagtgcagcatc
cgaaacatgtgcctaaacggaatgtgtattaatgaagatggcagtttcaagtgtatttgc
aaacctgggttccaactggcatcagatggccgctactgcaaagatatcaatgagtgtgag
acacctgggatctgcatgaacggacgctgtgtgaacacggatggctcctacagatgcgaa
tgcttccccggattggctgtgggtctagacggacgtgtgtgtgttgacacacacatgcgg
agcacatgctatggaggatacaggagaggccagtgcgtgaagccgttgtttggtgctgtt
accaaatcggaatgctgttgtgccagcactgagtatgcctttggggaaccctgccagccg
tgtcctgcacagaattcagcggaatatcaggcactctgcagcagtggaccgggaatgaca
tcagcaggcactgatataaacgaatgtgcattagatcctgatatttgcccaaatggaatt
tgtgaaaatctccgtgggacctacaaatgtatatgcaactcgggatatgaagtagacata
actgggaaaaactgtgtcgatattaatgagtgtgtgctgaacagtctactttgtgacaat
ggacaatgtcgaaacacacctggaagttttgtctgcacctgccccaaaggatttgtgtac
aaacctgacctaaaaacctgtgaagacattgatgaatgtgaatcgagtccttgcattaat
ggagtctgcaagaacagccctggctccttcatttgtgaatgttctcctgaaagtactctg
gacccaacaaaaaccatctgcatagaaaccatcaagggcacttgctggcagactgtcatc
gacgggcgctgtgagatcaacatcaacggagccaccttgaagtccgagtgctgctcctcc
cttggtgctgcgtgggggagcccgtgcaccatctgtcaacttgatcccatttgtggtaaa
gggttctcaagaattaaaggcacgcaatgtgaagatatcaatgagtgtgaagtgttcccg
ggagtatgcaagaacggcctgtgtgtcaactccaggggttcattcaagtgcgagtgtccc
aatggaatgactttggatgctacaggaagaatctgtcttgacatccgcctggagacctgc
ttcctcaagtatgacgatgaagagtgcaccttgcccatcgctggccgccaccgaatggat
gcctgctgctgctctgttggggcagcctggggaacggaagagtgtgaggagtgtccattg
agaaacagccgggagtatgaggaactctgtccccgaggacctgggtttgccacaaaagac
attacaaatgggaaacctttcttcaaagatatcaatgagtgcaagatgatacccagcctc
tgtacccacggcaagtgcaggaacaccattggcagcttcaagtgtaggtgtgacagtggc
tttgctctggattctgaagagaggaactgtacagacattgatgagtgccgcatatctcct
gacctctgtggccgaggccagtgtgtgaacaccccgggggactttgaatgcaagtgtgat
gaaggctatgaaagtggcttcatgatgatgaagaactgcatggatattgatgaatgtcag
agagatcctctcctgtgtcgaggaggcatttgccacaacacagagggaagctatcgctgc
gaatgtcctcctggtcaccaattgtccccaaacatctctgcatgcattgacatcaacgag
tgtgagctgagtgcgaatctctgtccccatgggcgttgtgtgaacctcatagggaagtac
cagtgtgcctgcaaccctggctaccaccccactcatgacaggctcttctgtgtcgatatt
gatgaatgcagcataatgaacggtggttgtgagaccttctgcacaaactctgacgggagc
tatgaatgtagctgtcagccaggcttcgcgctaatgccagaccagcgatcgtgcacagac
attgatgagtgtgaagacaaccccaatatctgtgatggtggccagtgcacaaacatacct
ggggagtacaggtgcctgtgctatgatgggttcatggcatctgaagacatgaagacttgt
gtggatgtcaatgagtgtgacctgaatccaaacatctgccttagtgggacctgtgaaaat
actaaaggctcgttcatctgccactgtgatatgggatattcagggaagaaaggaaaaacg
ggctgtacagatatcaatgaatgtgagatcggagcacacaactgtggcagacatgctgta
tgcacaaatacagccgggagcttcaagtgcagctgcagtcccggctggattggagacggc
attaagtgcacagatctggatgaatgctctaatggaacccacatgtgcagccaacacgcg
gactgcaagaacaccatggggtcatatcgctgtctctgtaaggatggctatacaggggat
ggcttcacctgtacagacctcgacgagtgctccgagaacctgaacctctgtggcaatggc
cagtgcctcaacgcccctggcgggtaccgctgtgaatgcgacatgggcttcgtgcccagt
gctgacgggaaggcctgtgaagatatcgatgagtgctcccttccaaacatctgtgtcttt
ggaacttgccacaacctcccgggcctcttccgttgcgagtgtgagattggctatgaactg
gaccgaagtggtggaaactgcacagatgttaatgagtgtctggatcccaccacctgcatc
agtggaaactgtgtcaacactcccggtagttacacatgcgattgtcctccggattttgag
ctgaatccaactcgtgtcggctgtgtcgatactcgctctggaaactgctatctggatatc
cgaccccggggagacaatggagatacagcctgcagcaatgaaattggagttggtgtctct
aaggcttcctgctgttgttcactgggtaaagcttggggaaccccatgtgagctgtgtcct
tctgtgaacacatctgagtataaaattctttgccctggaggagaaggttttcgtccaaat
cccatcaccgttatattggaagacatcgatgagtgccaggagcttccagggctgtgccaa
ggggggaagtgcatcaatacctttggcagcttccagtgtcgctgtccaactggttactac
ctgaatgaagacactcgagtgtgtgatgatgtgaacgaatgtgagactcctggaatctgt
ggtccggggacctgttacaacaccgttggcaactatacctgcatttgtcctccagactac
atgcaagtgaacgggggaaataattgcatggacatgagaagaagtctatgctacagaaac
tattacgctgacaaccagacctgcgatggagaactcctgttcaacatgaccaagaagatg
tgctgttgctcctacaacatcggcagagcctggaacaaaccctgtgaacagtgccccatc
ccaagcacagatgagtttgctaccctctgtgggagccagaggcccggcttcgtgattgac
atttatacgggtttacccgtggatattgatgaatgccgggagatccctggggtctgtgaa
aatggagtgtgcatcaacatggttggcagcttccggtgtgagtgtcccgtgggattcttc
tataacgacaagttactggtttgtgaagatatcgacgagtgtcagaatggccctgtgtgc
cagcgaaatgcggaatgcatcaacactgcaggcagctaccgctgtgactgtaagcccggc
taccgccttacctccacaggtcaatgcaacgatcgaaacgagtgccaagaaatcccgaac
atatgcagtcatggccagtgcatcgacaccgtgggaagcttctactgcctttgtcacact
ggcttcaaaacaaatgtggatcagaccatgtgcttagacataaatgagtgtgagagagac
gcctgtgggaacgggacttgcagaaacacgattggctccttcaactgtcgctgtaaccat
ggcttcatactgtctcacaacaatgactgcatagatgttgatgagtgtgcaactggaaac
gggaacctttgcagaaatggccagtgtgtcaataccgtgggctcctttcagtgcaggtgc
aatgaaggctatgaggtggctccggacggcaggacctgtgtggatatcaacgagtgtgtt
ctggatcctgggaaatgtgcacctggaacctgtcagaacctggatggctcctacagatgc
atttgcccgcctgggtatagtctacagaatgacaagtgtgaagatattgatgagtgtgtt
gaagagccagaaatctgtgccttggggacctgcagcaacactgagggtagcttcaaatgt
ctgtgtccagaggggttctccctgtcctccactggaagaaggtgccaagatttgcgaatg
agctactgctatgcgaagtttgaaggtgggaagtgttcatcacccaaatccagaaaccat
tccaagcaggagtgctgctgtgctttgaagggagaaggctggggagatccttgtgagttg
tgccccactgagccagatgaggctttccgccagatctgcccctttggaagtgggatcatt
gtgggccctgatgactcagcagttgatatggacgaatgcaaagaacctgatgtctgtaga
catgggcagtgcattaacacagacggctcctatcgatgcgagtgtccttttggttatatt
ctggaagggaatgagtgtgtggataccgatgaatgctctgtgggcaatccttgtggaaat
gggacctgcaagaatgtgattggaggttttgaatgtacctgtgaggaggggttcgagcct
ggcccaatgatgacttgtgaagatataaatgaatgtgcccagaatcctctgctctgcgcc
ttccgctgtgtaaatacctacgggtcctatgaatgcaaatgccctgttggatacgttctc
cgagaagacaggaggatgtgtaaagatgaggatgagtgtgcagagggaaaacacgactgt
actgagaagcaaatggagtgtaagaacctcattggtacctacatgtgcatctgcggccct
gggtaccagcgcagacccgatggagagggctgcatagatgagaatgagtgtcagaccaag
cccgggatctgtgagaatgggcgttgcctcaacaccctgggtagctacacttgtgagtgt
aacgatggcttcacagccagccccactcaggatgagtgcttggacaaccgggaagggtac
tgcttttcggaggtcttgcaaaacatgtgccagattggctcaagcaacaggaaccccgtc
accaagtccgagtgctgctgtgatggagggagaggctggggaccccactgtgagatctgc
cctttcgagggcacagtggcttacaagaagctctgtccccacggccgaggattcatgacc
aacggagcagatattgatgagtgcaaggttattcatgatgtttgccgaaatggggagtgt
gtcaacgacagagggtcctatcactgcatctgtaaaactggctacactccggatataaca
gggaccgcctgtgtagatctgaatgaatgcaaccaggctcccaaaccctgcaattttata
tgcaaaaacacagaagggagttaccagtgttcctgcccgaagggctacattctgcaagag
gatggaaggagctgcaaagatcttgacgagtgtgcaaccaagcagcataactgtcagttc
ctgtgtgttaacaccatcggtggcttcacatgcaaatgccctcctgggtttacccagcat
cacactgcctgcattgataacaatgagtgcacgtctgatatcaacctgtgtgggtccaag
ggtgtttgccagaacactccaggaagcttcacctgtgaatgccaacgggggttctcactc
gatcagagtggtgccagctgtgaagatgtggacgagtgtgagggtaaccaccgctgtcaa
catggctgccagaacatcatcggaggctataggtgtagctgcccccagggctacctccag
cactaccaatggaaccagtgtgtagatgaaaacgagtgcctgagtgcacatgtctgtgga
ggagcctcctgccacaacaccctggggagttacaagtgcatgtgtcccaccggcttccag
tacgaacagttcagtggaggctgccaagacatcaatgagtgtggctcatcccaggccccc
tgcagttacggttgctctaatactgagggtggctacctgtgtggctgtccaccaggatac
ttccggataggccaagggcattgtgtttctggaatgggcatgggccgaggcggcccagag
ccacctgccagcagcgagatggacgacaactcactgtccccagaggcctgctatgagtgt
aagatcaacggctacccaaaacgaggccggaaacggagaagcacgaacgaaacggatgcc
tccgacatccaggacgggtctgagatggaagccaacgtgagcctcgccagctgggatgtg
gagaagccggctagctttgctttcaatatttcccatgtcaataacaaggtccgaatccta
gagctcctgccggccctcacaactctgatgaaccacaacagatacttgattgaatctgga
aatgaagatggcttctttaaaatcaaccagaaagaaggggtcagctacctccacttcacg
aagaagaagccggtggctgggacctactccttacaaatcagcagcaccccactttataaa
aagaaagaacttaaccagttagaagacagatatgacaaagactacctcagtggtgaactg
ggcgataacctgaagatgaaaattcagatcttgctgcattaa

DBGET integrated database retrieval system