KEGG   Mus musculus (mouse): 14121
Entry
14121             CDS       T01002                                 

Symbol
Fbp1, Fbp, Fbp-, Fbp-2, Fbp2, Fbp3
Name
(RefSeq) fructose bisphosphatase 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00030  Pentose phosphate pathway
mmu00051  Fructose and mannose metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04922  Glucagon signaling pathway
Module
mmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    14121 (Fbp1)
   00030 Pentose phosphate pathway
    14121 (Fbp1)
   00051 Fructose and mannose metabolism
    14121 (Fbp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    14121 (Fbp1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    14121 (Fbp1)
   04922 Glucagon signaling pathway
    14121 (Fbp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14121 (Fbp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     14121 (Fbp1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   14121 (Fbp1)
SSDB
Motif
Pfam: FBPase FBPase_C Inositol_P
Other DBs
NCBI-GeneID: 14121
NCBI-ProteinID: NP_062268
MGI: 95492
Ensembl: ENSMUSG00000069805
Vega: OTTMUSG00000026406
UniProt: Q9QXD6
Position
13; 13 B3
AA seq 338 aa
MANHAPFETDISTLTRFVMEQGRKAQGTGELTQLLNSLCTAIKAISSAVRQAGIAQLYGI
AGSTNVTGDQVKKLDILSNDLVINMLKSSYATCVLVSEENTNAIIIEPEKRGKYVVCFDP
LDGSSNIDCLVSIGTIFGIYRKKSTDEPSEKDALQPGRDLVAAGYALYGSATMLVLAMDC
GVNCFMLDPSIGEFIMVDRDVKMKKKGNIYSLNEGYAKDFDPAINEYLQRKKFPPDGSAP
YGARYVGSMVADIHRTLVYGGIFLYPANKKSPSGKLRLLYECNPIAYVMEKAGGLATTGD
KDILDIVPTEIHQKAPVVMGSSEDVQEFLEIYRKHKAK
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggcgaaccatgcgcccttcgaaacggatatcagcaccctgacccgcttcgtcatggag
cagggcaggaaggctcagggcacgggggagttgacccagctgctgaattcgctctgcacc
gcgatcaaagccatctcgtctgcggtgcgccaggcgggcatcgcacagctctatggtatc
gctggctcaaccaatgtgactggggatcaagtaaagaagctggacatactttccaatgac
ctggtgatcaatatgctgaagtcgtcctacgctacctgtgttcttgtgtctgaagaaaac
acaaatgccatcataatcgaacctgagaagaggggcaaatatgttgtctgtttcgatccc
cttgatggctcatccaacattgactgccttgtgtccatcggaaccatttttggcatttac
agaaagaaaagtactgatgagccttctgagaaggatgctctgcagcccggccgggacctg
gtggcagccgggtatgcgctctatggcagtgccaccatgttggtccttgccatggattgt
ggtgtcaactgcttcatgctggacccgtccattggagaattcattatggtggacagggac
gtgaagatgaagaagaaaggtaacatctacagccttaatgagggttatgccaaggacttt
gaccctgccatcaatgagtatctccagaggaaaaagttccctccggatggttcagccccc
tatggtgcccggtatgtggggtccatggtggctgatattcaccgcactctggtatatgga
gggatctttttataccccgccaacaagaaaagcccaagtggaaagctgcggctgctgtat
gagtgcaaccccatagcttatgtcatggagaaggccggtgggctcgccaccacgggggac
aaagatatattagacatcgttcccaccgagatccaccagaaggcaccagtcgtcatgggg
tcctctgaagatgtgcaggagttcctggagatctacaggaagcacaaagccaagtga

DBGET integrated database retrieval system