KEGG   Mus musculus (house mouse): 14123
Entry
14123             CDS       T01002                                 
Symbol
Fbrs, Fbs, Fbs1
Name
(RefSeq) fibrosin
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Auts2
Other DBs
NCBI-GeneID: 14123
NCBI-ProteinID: NP_034313
MGI: 104648
Ensembl: ENSMUSG00000042423
UniProt: Q8R089
Position
7:127075925..127090685
AA seq 980 aa
METAAAPGPGWAAEGERRRRRCSRRDRDREQRRRRGPGGDAPRALLAAPRGSSSSSSPPP
PARPWSSASSGERPGGLRRRRPRPRPRPPRPRARKRPAGSGSRGEEEDEEEEGGADDGEA
EEEPEEEEEEEDLIDGFAIASFASLEALQKDASLQPPERLEHRLKHSGKRKRGGSSGATG
EPGDSSDREPGRPSGDRPRKWPNKRRRKEAFSRHSLEAGYICDAESDLDERVSDDDLDPS
FTVSTSKASGPHGTFNGNCEAKLSVVPKVSGLERSQEQPPGPDPLLVPFPPKDPPPPPAP
RPPVSSPTPLPATPSLPPPPQHQLQLRVSPFGLRSSPYGSSLDLSTGSSSRPPPKAPAPP
VAQPPPSSSSSSSSSSSASSSSAQLTHRPPTPSLPLPLSTHSFPPHGLRPPPPHHPSLVS
PGPTLPPPPPLLQVPGHPGASAANALSEQDLIGQDLNSRYLNAQGGPEVVGAGGSARPLA
FQFHQHNHQHQHTHQHTHQHFTPYPPGLLPPHGHMFEKYPGKMEGLFRHNPYMAFPPAVP
GLPPGLPPAVSFGSLQGAFQPKNTNPELPPRLGPVLSGLPQKGTQIPDHFRPPLRKPGKW
CAMHVRVAYMILRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGA
VHAAANPFTTAPGAHGPFLSPSTHIDPFGRPTSFASLAALSNGAFGGLGSPTFNSSAVFA
QKESPGAPPAFASPPDPWGRLHRSPLAFPAWVRPPETARTPGSDKERPMERREPSVTKEE
KDRDLPFSRPQLRVSPATPKARAGEEGARPAKESVRVKEERKEEAAAAAAAAAAAAAAAA
AAAAAAAATTGPQGLHLLLERPRPPPFLGPSLPERCAGFPEPTWLAGPPRLARPPRFYEA
GEELTGPGAMAAARLYSLDPAHPLLYSRLAPPPPPTATPGTPHLLSKTPPGALLGAPPPL
VPAPRPSSPPRAPGPARADR
NT seq 2943 nt   +upstreamnt  +downstreamnt
atggagacggccgcggccccaggcccgggctgggcagctgaaggggagcggcgacggaga
cgctgctcgcggcgagaccgtgatcgggagcagcggcgccgccgaggtccaggcggtgac
gcgccccgggccttgttggccgccccgcgaggctcttcatcctcctcgtcaccgccgccg
cccgcccgtccctggtcgtcagcttcatctggagagcggcctgggggcctacgacggcgg
cggccccgacccaggcctcgacccccgagaccgcgagctcggaagcggcctgccggttcg
ggcagccgcggagaggaagaggacgaggaggaagaggggggcgcagacgacggagaagcc
gaggaggagcctgaggaggaggaagaggaggaagacctgatcgatggttttgccatcgct
agctttgccagccttgaggccttgcagaaggatgcatctcttcagcccccagaacgactg
gaacatcggctgaagcattctgggaaacggaagagggggggctccagtggggccactggg
gaaccaggggacagctcagaccgtgagcctggccgaccctctggggataggccccgtaaa
tggcccaataagcgaagaaggaaagaggccttctcccgtcactctctggaagctggatat
atatgtgacgcagaaagtgatctggatgagagggtctcagatgatgacctcgacccttcc
ttcactgtctcgaccagcaaagcctcgggtcctcatggcaccttcaatgggaactgtgaa
gcaaaactgtctgtggtccctaaagtgtcgggcctggagcggagccaagagcagcccccg
gggcccgacccgctgctagtgcctttccccccaaaggatccaccacctccaccagcccct
cggcctcctgtctcatcccctacacccttaccagctacccccagtctgccacccccaccc
cagcaccagctgcagcttcgggtctcacccttcggcctccgaagttctccctatggcagc
agcctggacctcagcactggcagctcttcacggccgccccccaaggccccggcccctccc
gtggctcagcctcccccctcatcatcctcttcgtcctcctcctcctcatctgcctcctcc
tcgtccgcgcagctcacccaccggcccccgacgccctcactgcccctgcctctgtccacc
cacagctttcctccccatgggttgcgcccaccaccaccccaccacccttccttggtctcc
cctggccccaccctgcccccacccccacctctgctgcaggtgccagggcaccctggggcc
tcagctgctaacgccctttctgagcaggacctgatcggccaggacctgaactcacgctac
ctgaatgcccagggtggccctgaggtggtgggagcagggggctcggcccggcccctggcc
ttccagttccaccagcacaaccaccagcaccagcacacccaccagcacacccaccagcac
ttcactccctaccccccgggcctgctgcctccccacggccacatgtttgagaaataccca
ggaaagatggaaggccttttccgacataatccgtacatggccttccctcccgctgtgccc
gggctccctccgggtctcccaccagctgtctcctttggctccctgcagggggccttccag
cccaagaacacgaaccctgagctgccaccacgactggggccagtgctgagcgggctaccc
cagaaggggacacagatccctgatcatttccggccacctttgaggaaaccaggaaaatgg
tgtgccatgcacgttcgtgtggcttacatgatcctgagacaccaggaaaagatgaagggt
gactcccacaagcttgactttcggaacgacctcctaccctgccttccggggccctatggg
gccctgccccctgggcaggagctctcccacccggcctctctcttcactgcgactggagcc
gtccatgctgcagccaatcctttcacaacagctcctggggcccatggacccttcttgagc
cccagtacccacattgatccctttgggcgtcccacaagctttgcctccttggctgctctc
tccaacggggcctttggaggcctgggcagccccacattcaactccagcgccgtctttgcc
cagaaagaaagcccaggagccccaccagcctttgcctccccaccagacccatggggccgc
ctgcaccgcagtcctcttgcctttcctgcttgggtccgtccccctgaaactgcccggaca
ccaggctcagataaggagcgacctatggagcgaagagagccctctgtcaccaaggaggag
aaggacagggacctccctttctcacggcctcagcttcgagtttctcctgctactcctaag
gccagggctggcgaggaaggagcccgaccagccaaagagtctgtgcgggtaaaagaagag
cggaaagaagaggctgctgctgctgccgccgccgctgctgccgctgcagctgctgctgct
gctgccgctgctgccgctgctgcaaccactgggcctcaaggtcttcacttgcttttggag
aggcctcggccacccccatttcttggccctagcctgccagagcgctgtgcaggcttccca
gagccaacctggttggcagggcccccacgcctggccaggccaccacgcttctatgaggca
ggtgaggagttgactggaccaggggccatggctgctgcccgcctctatagtctagaccct
gctcatccactgctatacagccgtttggctcctccaccaccacctactgcaactccagga
acccctcaccttctcagcaagaccccaccaggagcccttttaggagcaccaccacctctt
gtgcccgccccccggcccagttccccacctagggcccctggcccagcccgggctgacagg
tga

DBGET integrated database retrieval system