KEGG   Mus musculus (mouse): 14125
Entry
14125             CDS       T01002                                 

Gene name
Fcer1a, FcE, FcERI, Fce1, Fce1a, Fcr-, Fcr-5, fcepsilonri
Definition
(RefSeq) Fc receptor, IgE, high affinity I, alpha polypeptide
  KO
K08089  high affinity immunoglobulin epsilon receptor subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu05310  Asthma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    14125 (Fcer1a)
   04071 Sphingolipid signaling pathway
    14125 (Fcer1a)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    14125 (Fcer1a)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    14125 (Fcer1a)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Ig_5 I-set Ig_4 Ig_6 C2-set Herpes_gI
Other DBs
NCBI-GeneID: 14125
NCBI-ProteinID: NP_034314
MGI: 95494
Ensembl: ENSMUSG00000005339
Vega: OTTMUSG00000050168
UniProt: P20489
Position
1 H3; 1 80.33 cM
AA seq 250 aa
MVTGRSAQLCLALLFMSLDVILTATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNST
TKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADM
VLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQ
VKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGK
YKKVETELLT
NT seq 753 nt   +upstreamnt  +downstreamnt
atggtcactggaaggtctgcccagctgtgcctagcactgctgttcatgtctcttgatgtc
attctgacagccactgagaaatctgtactgaccttggacccaccatggattagaatattt
acaggagagaaagtgaccctttcctgctatgggaacaatcaccttcaaatgaactctact
actaaatggatccacaatggtaccgtctctgaggtgaactcttcacatttggtcattgtg
agtgccaccgttcaagacagtggaaaatacatatgtcagaagcaaggattgtttaagagt
aaacctgtgtacttgaatgtaacgcaagattggctgctccttcagacatctgctgacatg
gtcttagtccatggatcctttgacatcagatgccatggctggaagaactggaatgtccgc
aaggtgatctactacaggaatgaccatgctttcaactacagttatgagagccccgtctcc
attagagaggccacactgaatgacagtggcacctaccactgcaagggctatcttaggcag
gtgaaatatgaatctgacaaattcagaattgctgtagtaaaagcttacaaatgcaagtat
tattggctacaactaattttcccattgttggtggcgattctgtttgctgtggacacgggg
ttattgctctcaaccgaagaacagttcaaatcagtcttggagattcagaagactggaaaa
tacaagaaagttgaaaccgaactcctaacctag

DBGET integrated database retrieval system