KEGG   Mus musculus (mouse): 14126
Entry
14126             CDS       T01002                                 

Gene name
Ms4a2, FcR, FcRB, Fce1b, Fcer1, Fcer1b, Fcrbe, Fcrbeta, Ms4a1, fcERI
Definition
(RefSeq) membrane-spanning 4-domains, subfamily A, member 2
  KO
K08090  high affinity immunoglobulin epsilon receptor subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu05310  Asthma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    14126 (Ms4a2)
   04071 Sphingolipid signaling pathway
    14126 (Ms4a2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    14126 (Ms4a2)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    14126 (Ms4a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14126 (Ms4a2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14126 (Ms4a2)
SSDB
Motif
Pfam: CD20 DUF6114 Afaf
Other DBs
NCBI-GeneID: 14126
NCBI-ProteinID: NP_038544
MGI: 95495
Ensembl: ENSMUSG00000024680
Vega: OTTMUSG00000047239
UniProt: P20490 B2RTF7 Q3UNT6
Position
19 A; 19 8.46 cM
AA seq 235 aa
MDTENRSRADLALPNPQESSSAPDIELLEASPAKAAPPKQTWRTFLKKELEFLGATQILV
GLICLCFGTIVCSVLYVSDFDEEVLLLYKLGYPFWGAVLFVLSGFLSIISERKNTLYLVR
GSLGANIVSSIAAGTGIAMLILNLTNNFAYMNNCKNVTEDDGCFVASFTTELVLMMLFLT
ILAFCSAVLFTIYRIGQELESKKVPDDRLYEELNVYSPIYSELEDKGETSSPVDS
NT seq 708 nt   +upstreamnt  +downstreamnt
atggacacagaaaataggagcagagcagatcttgctctcccaaatccacaagaatcctcc
agtgcacctgacattgaactcttggaagcatctcctgccaaagcagccccaccaaagcag
acatggcggacatttttgaagaaagagttggagttcctgggagcaacacaaattctggtt
ggtttgatatgcctttgttttggaacaattgtctgctccgtactctatgtttcagacttt
gatgaagaagtgcttttactttataaactaggctatccattctggggtgcagtgctgttt
gttttgtctggatttttgtcaattatctccgaaagaaaaaacacattgtatctggtgaga
ggcagcctgggagcaaacattgtcagtagcatcgctgcagggacggggatcgccatgctg
atcctcaatctgaccaataacttcgcttatatgaacaactgcaagaatgtaaccgaagac
gacggctgctttgtggcttctttcaccacagaactggtgttgatgatgctgtttctcacc
atcctggccttttgcagtgctgtgttgttcactatctataggattggacaagagttagaa
agtaaaaaggtcccagatgatcgtctttatgaagaattaaatgtgtattcaccaatttac
agtgagttggaagacaaaggggaaacatcttctccagttgattcataa

DBGET integrated database retrieval system