Entry |
|
Symbol |
Fcer1g, CD23, FcR-gamma, FcR[g], FcRgamma, Fce1g, FcepsilonRI, Ly-50
|
Name |
(RefSeq) Fc receptor, IgE, high affinity I, gamma polypeptide
|
KO |
K07983 | high affinity immunoglobulin epsilon receptor subunit gamma |
|
Organism |
mmu Mus musculus (house mouse)
|
Pathway |
mmu04072 | Phospholipase D signaling pathway |
mmu04625 | C-type lectin receptor signaling pathway |
mmu04650 | Natural killer cell mediated cytotoxicity |
mmu04664 | Fc epsilon RI signaling pathway |
|
Brite |
KEGG Orthology (KO) [BR:mmu00001]
09130 Environmental Information Processing
09132 Signal transduction
04072 Phospholipase D signaling pathway
14127 (Fcer1g)
04071 Sphingolipid signaling pathway
14127 (Fcer1g)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
14127 (Fcer1g)
04650 Natural killer cell mediated cytotoxicity
14127 (Fcer1g)
04664 Fc epsilon RI signaling pathway
14127 (Fcer1g)
09160 Human Diseases
09171 Infectious disease: bacterial
05152 Tuberculosis
14127 (Fcer1g)
09163 Immune disease
05310 Asthma
14127 (Fcer1g)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:mmu04147]
14127 (Fcer1g)
Exosome [BR:mmu04147]
Exosomal proteins
Exosomal proteins of microglial cells
14127 (Fcer1g)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
Position |
1:complement(171057141..171061918)
|
AA seq |
86 aa
MISAVILFLLLLVEQAAALGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREK
ADAVYTGLNTRSQETYETLKHEKPPQ |
NT seq |
261 nt +upstreamnt +downstreamnt
atgatctcagccgtgatcttgttcttgctccttttggtggaacaagcagccgccctggga
gagccgcagctctgctatatcctggatgctgtcctgtttttgtatggtattgtccttacc
ctactctactgtcgactcaagatccaggtccgaaaggcagctatagccagccgtgagaaa
gcagatgctgtctacacgggcctgaacacccggagccaggagacatatgagactctgaag
catgagaaaccaccccagtag |