KEGG   Mus musculus (mouse): 14127Help
Entry
14127             CDS       T01002                                 

Gene name
Fcer1g, AI573376, CD23, FcR-gamma, FcR[g], FcRgamma, Fce1g, FcepsilonRI, Ly-50
Definition
(RefSeq) Fc receptor, IgE, high affinity I, gamma polypeptide
  KO
K07983  high affinity immunoglobulin epsilon receptor subunit gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04611  Platelet activation
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04664  Fc epsilon RI signaling pathway
mmu05152  Tuberculosis
mmu05310  Asthma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    14127 (Fcer1g)
   04071 Sphingolipid signaling pathway
    14127 (Fcer1g)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    14127 (Fcer1g)
   04625 C-type lectin receptor signaling pathway
    14127 (Fcer1g)
   04650 Natural killer cell mediated cytotoxicity
    14127 (Fcer1g)
   04664 Fc epsilon RI signaling pathway
    14127 (Fcer1g)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    14127 (Fcer1g)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    14127 (Fcer1g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14127 (Fcer1g)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   14127 (Fcer1g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TCR_zetazeta ITAM
Motif
Other DBs
NCBI-GeneID: 14127
NCBI-ProteinID: NP_034315
MGI: 95496
Ensembl: ENSMUSG00000058715
Vega: OTTMUSG00000021504
UniProt: P20491
Position
1 H3; 1 79.23 cM
AA seq 86 aa AA seqDB search
MISAVILFLLLLVEQAAALGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREK
ADAVYTGLNTRSQETYETLKHEKPPQ
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgatctcagccgtgatcttgttcttgctccttttggtggaacaagcagccgccctggga
gagccgcagctctgctatatcctggatgctgtcctgtttttgtatggtattgtccttacc
ctactctactgtcgactcaagatccaggtccgaaaggcagctatagccagccgtgagaaa
gcagatgctgtctacacgggcctgaacacccggagccaggagacatatgagactctgaag
catgagaaaccaccccagtag

DBGET integrated database retrieval system