KEGG   Mus musculus (mouse): 14129Help
Entry
14129             CDS       T01002                                 

Gene name
Fcgr1, AI323638, AV092959, CD64, FcgammaRI, IGGHAFC
Definition
(RefSeq) Fc receptor, IgG, high affinity I
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04640  Hematopoietic cell lineage
mmu04666  Fc gamma R-mediated phagocytosis
mmu05140  Leishmaniasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    14129 (Fcgr1)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    14129 (Fcgr1)
   04666 Fc gamma R-mediated phagocytosis
    14129 (Fcgr1)
  Development
   04380 Osteoclast differentiation
    14129 (Fcgr1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    14129 (Fcgr1)
   05221 Acute myeloid leukemia
    14129 (Fcgr1)
  Immune diseases
   05322 Systemic lupus erythematosus
    14129 (Fcgr1)
  Infectious diseases
   05150 Staphylococcus aureus infection
    14129 (Fcgr1)
   05152 Tuberculosis
    14129 (Fcgr1)
   05140 Leishmaniasis
    14129 (Fcgr1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    14129 (Fcgr1)
CD molecules [BR:mmu04090]
 Proteins
  14129 (Fcgr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig V-set
Motif
Other DBs
NCBI-GeneID: 14129
NCBI-ProteinID: NP_034316
MGI: 95498
Ensembl: ENSMUSG00000015947
Vega: OTTMUSG00000053089
UniProt: P26151
Position
3 F2.1; 3 41.72 cM
AA seq 404 aa AA seqDB search
MILTSFGDDMWLLTTLLLWVPVGGEVVNATKAVITLQPPWVSIFQKENVTLWCEGPHLPG
DSSTQWFINGTAVQISTPSYSIPEASFQDSGEYRCQIGSSMPSDPVQLQIHNDWLLLQAS
RRVLTEGEPLALRCHGWKNKLVYNVVFYRNGKSFQFSSDSEVAILKTNLSHSGIYHCSGT
GRHRYTSAGVSITVKELFTTPVLRASVSSPFPEGSLVTLNCETNLLLQRPGLQLHFSFYV
GSKILEYRNTSSEYHIARAEREDAGFYWCEVATEDSSVLKRSPELELQVLGPQSSAPVWF
HILFYLSVGIMFSLNTVLYVKIHRLQREKKYNLEVPLVSEQGKKANSFQQVRSDGVYEEV
TATASQTTPKEAPDGPRSSVGDCGPEQPEPLPPSDSTGAQTSQS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattcttaccagctttggagatgacatgtggcttctaacaactctgctactttgggtt
ccagtcggtggggaagtggttaatgccaccaaggctgtgatcaccttgcagcctccatgg
gtcagtattttccagaaggaaaatgtcactttatggtgtgaggggcctcacctgcctgga
gacagttccacacaatggtttatcaacggaacagccgttcagatctccacgcctagttat
agcatcccagaggccagttttcaggacagtggcgaatacaggtgtcagataggttcctca
atgccaagtgaccctgtgcagttgcaaatccacaatgattggctgctactccaggcctcc
cgcagagtcctcacagaaggagaacccctggccttgaggtgtcacggatggaagaataaa
ctggtgtacaatgtggttttctatagaaatggaaaatcctttcagttttcttcagattcg
gaggtcgccattctgaaaaccaacctgagtcacagcggcatctaccactgctcaggcacg
ggaagacaccgctacacatctgcaggagtgtccatcacggtgaaagagctgtttaccacg
ccagtgctgagagcatccgtgtcatctcccttcccggaggggagtctggtcaccctgaac
tgtgagacgaatttgctcctgcagagacccggcttacagcttcacttctccttctacgtg
ggcagcaagatcctggagtacaggaacacatcctcagagtaccatatagcaagggcggaa
agagaagatgctggattctactggtgtgaggtagccacggaggacagcagtgtccttaag
cgcagccctgagttggagctccaagtgcttggtccccagtcatcagctcctgtctggttt
cacatcctgttttatctgtcagtgggaataatgttttcgttgaacacggttctctatgtg
aaaatacacaggctgcagagagagaagaaatacaacttagaagtccctttggtttctgag
cagggaaagaaagcaaattcctttcagcaagttagaagcgatggcgtgtatgaagaagta
acagccactgcgagccagaccacaccaaaagaagcgcccgatggacctcgaagctcagtg
ggtgactgtggacccgagcagcctgaaccccttcctcccagtgacagtactggggcacaa
acttcccaaagttga

DBGET integrated database retrieval system