KEGG   Mus musculus (mouse): 14129
Entry
14129             CDS       T01002                                 

Gene name
Fcgr1, AI323638, AV092959, CD64, FcgammaRI, IGGHAFC
Definition
(RefSeq) Fc receptor, IgG, high affinity I
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04640  Hematopoietic cell lineage
mmu04666  Fc gamma R-mediated phagocytosis
mmu05140  Leishmaniasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14129 (Fcgr1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14129 (Fcgr1)
   04666 Fc gamma R-mediated phagocytosis
    14129 (Fcgr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14129 (Fcgr1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    14129 (Fcgr1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    14129 (Fcgr1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    14129 (Fcgr1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14129 (Fcgr1)
   05152 Tuberculosis
    14129 (Fcgr1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    14129 (Fcgr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14129 (Fcgr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14129 (Fcgr1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    14129 (Fcgr1)
CD molecules [BR:mmu04090]
 Proteins
  14129 (Fcgr1)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set
Other DBs
NCBI-GeneID: 14129
NCBI-ProteinID: NP_034316
MGI: 95498
Ensembl: ENSMUSG00000015947
Vega: OTTMUSG00000053089
UniProt: P26151
Position
3 F2.1; 3 41.72 cM
AA seq 404 aa
MILTSFGDDMWLLTTLLLWVPVGGEVVNATKAVITLQPPWVSIFQKENVTLWCEGPHLPG
DSSTQWFINGTAVQISTPSYSIPEASFQDSGEYRCQIGSSMPSDPVQLQIHNDWLLLQAS
RRVLTEGEPLALRCHGWKNKLVYNVVFYRNGKSFQFSSDSEVAILKTNLSHSGIYHCSGT
GRHRYTSAGVSITVKELFTTPVLRASVSSPFPEGSLVTLNCETNLLLQRPGLQLHFSFYV
GSKILEYRNTSSEYHIARAEREDAGFYWCEVATEDSSVLKRSPELELQVLGPQSSAPVWF
HILFYLSVGIMFSLNTVLYVKIHRLQREKKYNLEVPLVSEQGKKANSFQQVRSDGVYEEV
TATASQTTPKEAPDGPRSSVGDCGPEQPEPLPPSDSTGAQTSQS
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgattcttaccagctttggagatgacatgtggcttctaacaactctgctactttgggtt
ccagtcggtggggaagtggttaatgccaccaaggctgtgatcaccttgcagcctccatgg
gtcagtattttccagaaggaaaatgtcactttatggtgtgaggggcctcacctgcctgga
gacagttccacacaatggtttatcaacggaacagccgttcagatctccacgcctagttat
agcatcccagaggccagttttcaggacagtggcgaatacaggtgtcagataggttcctca
atgccaagtgaccctgtgcagttgcaaatccacaatgattggctgctactccaggcctcc
cgcagagtcctcacagaaggagaacccctggccttgaggtgtcacggatggaagaataaa
ctggtgtacaatgtggttttctatagaaatggaaaatcctttcagttttcttcagattcg
gaggtcgccattctgaaaaccaacctgagtcacagcggcatctaccactgctcaggcacg
ggaagacaccgctacacatctgcaggagtgtccatcacggtgaaagagctgtttaccacg
ccagtgctgagagcatccgtgtcatctcccttcccggaggggagtctggtcaccctgaac
tgtgagacgaatttgctcctgcagagacccggcttacagcttcacttctccttctacgtg
ggcagcaagatcctggagtacaggaacacatcctcagagtaccatatagcaagggcggaa
agagaagatgctggattctactggtgtgaggtagccacggaggacagcagtgtccttaag
cgcagccctgagttggagctccaagtgcttggtccccagtcatcagctcctgtctggttt
cacatcctgttttatctgtcagtgggaataatgttttcgttgaacacggttctctatgtg
aaaatacacaggctgcagagagagaagaaatacaacttagaagtccctttggtttctgag
cagggaaagaaagcaaattcctttcagcaagttagaagcgatggcgtgtatgaagaagta
acagccactgcgagccagaccacaccaaaagaagcgcccgatggacctcgaagctcagtg
ggtgactgtggacccgagcagcctgaaccccttcctcccagtgacagtactggggcacaa
acttcccaaagttga

DBGET integrated database retrieval system