KEGG   Mus musculus (mouse): 14129
Entry
14129             CDS       T01002                                 

Gene name
Fcgr1, AI323638, AV092959, CD64, Fcgam, FcgammaRI, IGGHAFC
Definition
(RefSeq) Fc receptor, IgG, high affinity I
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04613  Neutrophil extracellular trap formation
mmu04640  Hematopoietic cell lineage
mmu04666  Fc gamma R-mediated phagocytosis
mmu05140  Leishmaniasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14129 (Fcgr1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14129 (Fcgr1)
   04613 Neutrophil extracellular trap formation
    14129 (Fcgr1)
   04666 Fc gamma R-mediated phagocytosis
    14129 (Fcgr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14129 (Fcgr1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    14129 (Fcgr1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    14129 (Fcgr1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14129 (Fcgr1)
   05152 Tuberculosis
    14129 (Fcgr1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    14129 (Fcgr1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    14129 (Fcgr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14129 (Fcgr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14129 (Fcgr1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    14129 (Fcgr1)
CD molecules [BR:mmu04090]
 Proteins
  14129 (Fcgr1)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set
Other DBs
NCBI-GeneID: 14129
NCBI-ProteinID: NP_034316
MGI: 95498
Ensembl: ENSMUSG00000015947
Vega: OTTMUSG00000053089
UniProt: P26151
Position
3 F2.1; 3 41.72 cM
AA seq 404 aa
MILTSFGDDMWLLTTLLLWVPVGGEVVNATKAVITLQPPWVSIFQKENVTLWCEGPHLPG
DSSTQWFINGTAVQISTPSYSIPEASFQDSGEYRCQIGSSMPSDPVQLQIHNDWLLLQAS
RRVLTEGEPLALRCHGWKNKLVYNVVFYRNGKSFQFSSDSEVAILKTNLSHSGIYHCSGT
GRHRYTSAGVSITVKELFTTPVLRASVSSPFPEGSLVTLNCETNLLLQRPGLQLHFSFYV
GSKILEYRNTSSEYHIARAEREDAGFYWCEVATEDSSVLKRSPELELQVLGPQSSAPVWF
HILFYLSVGIMFSLNTVLYVKIHRLQREKKYNLEVPLVSEQGKKANSFQQVRSDGVYEEV
TATASQTTPKEAPDGPRSSVGDCGPEQPEPLPPSDSTGAQTSQS
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgattcttaccagctttggagatgacatgtggcttctaacaactctgctactttgggtt
ccagtcggtggggaagtggttaatgccaccaaggctgtgatcaccttgcagcctccatgg
gtcagtattttccagaaggaaaatgtcactttatggtgtgaggggcctcacctgcctgga
gacagttccacacaatggtttatcaacggaacagccgttcagatctccacgcctagttat
agcatcccagaggccagttttcaggacagtggcgaatacaggtgtcagataggttcctca
atgccaagtgaccctgtgcagttgcaaatccacaatgattggctgctactccaggcctcc
cgcagagtcctcacagaaggagaacccctggccttgaggtgtcacggatggaagaataaa
ctggtgtacaatgtggttttctatagaaatggaaaatcctttcagttttcttcagattcg
gaggtcgccattctgaaaaccaacctgagtcacagcggcatctaccactgctcaggcacg
ggaagacaccgctacacatctgcaggagtgtccatcacggtgaaagagctgtttaccacg
ccagtgctgagagcatccgtgtcatctcccttcccggaggggagtctggtcaccctgaac
tgtgagacgaatttgctcctgcagagacccggcttacagcttcacttctccttctacgtg
ggcagcaagatcctggagtacaggaacacatcctcagagtaccatatagcaagggcggaa
agagaagatgctggattctactggtgtgaggtagccacggaggacagcagtgtccttaag
cgcagccctgagttggagctccaagtgcttggtccccagtcatcagctcctgtctggttt
cacatcctgttttatctgtcagtgggaataatgttttcgttgaacacggttctctatgtg
aaaatacacaggctgcagagagagaagaaatacaacttagaagtccctttggtttctgag
cagggaaagaaagcaaattcctttcagcaagttagaagcgatggcgtgtatgaagaagta
acagccactgcgagccagaccacaccaaaagaagcgcccgatggacctcgaagctcagtg
ggtgactgtggacccgagcagcctgaaccccttcctcccagtgacagtactggggcacaa
acttcccaaagttga

KEGG   Mus musculus (mouse): 14130
Entry
14130             CDS       T01002                                 

Gene name
Fcgr2b, AI528646, CD32, F630109E10Rik, Fc[g], Fc[g]RII, Fcg, FcgRII, Fcgamm, Fcgr, Fcgr2, Fcgr2a, Fcr-, Fcr-2, Fcr-3, Ly-1, Ly-17, Ly-m2, Ly-m20, LyM-, LyM-1, fcRII
Definition
(RefSeq) Fc receptor, IgG, low affinity IIb
  KO
K12560  low affinity immunoglobulin gamma Fc receptor II-b
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14130 (Fcgr2b)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    14130 (Fcgr2b)
   04666 Fc gamma R-mediated phagocytosis
    14130 (Fcgr2b)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14130 (Fcgr2b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    14130 (Fcgr2b)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14130 (Fcgr2b)
   05152 Tuberculosis
    14130 (Fcgr2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14130 (Fcgr2b)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14130 (Fcgr2b)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    14130 (Fcgr2b)
CD molecules [BR:mmu04090]
 Proteins
  14130 (Fcgr2b)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set Ig_5 Ig_4 C2-set DUF2613 DUF2973
Other DBs
NCBI-GeneID: 14130
NCBI-ProteinID: NP_034317
MGI: 95499
Ensembl: ENSMUSG00000026656
Vega: OTTMUSG00000021775
UniProt: P08101 A0A0B4J1G1
Position
1 H3; 1 78.02 cM
AA seq 293 aa
MGILPFLLIPMESNWTVHVFSRTLCHMLLWTAVLNLAAGTHDLPKAVVKLEPPWIQVLKE
DTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPV
DLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIP
KANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLPVLTIVAAVTGIAVAAIVIIL
VSLVYLKKKQVPDNPPDLEEAAKTEAENTITYSLLKHPEALDEETEHDYQNHI
NT seq 882 nt   +upstreamnt  +downstreamnt
atgggaatcctgccgttcctactgatccccatggagagcaactggactgtccatgtgttc
tcacggactttgtgccatatgctactgtggacagccgtgctaaatcttgctgctgggact
catgatcttccaaaggctgtggtcaaactcgagcccccgtggatccaggtgctcaaggaa
gacacggtgacactgacatgcgaagggacccacaaccctgggaactcttctacccagtgg
ttccacaatgggaggtccatccggagccaggtccaagccagctacacgtttaaggccaca
gtcaatgacagtggagaatatcggtgtcaaatggagcagacccgcctcagcgaccctgta
gatctgggagtgatttctgactggctgctgctccagacccctcagctggtgtttctggaa
ggggaaaccatcacgctaaggtgccatagctggaggaacaaactactgaacaggatctcg
ttcttccataatgaaaaatccgtgaggtatcatcactacagtagtaatttctctatccca
aaagccaaccacagtcacagtggggactactactgcaaaggaagtctaggaaggacactg
caccagtccaagcctgtcaccatcactgtccaagggcccaagtccagcaggtctttacca
gtattgacaattgtggctgctgtcactgggattgctgtcgcagccattgttattatccta
gtatccttggtctatctcaagaaaaagcaggttccagacaatcctcctgatctggaagaa
gctgccaaaactgaggctgagaatacgatcacctactcacttctcaagcatcccgaagcc
ctggatgaagaaacagagcatgattaccagaaccacatttag

KEGG   Mus musculus (mouse): 14131
Entry
14131             CDS       T01002                                 

Gene name
Fcgr3, CD16, Fcgam
Definition
(RefSeq) Fc receptor, IgG, low affinity III
  KO
K16824  low affinity immunoglobulin gamma Fc receptor II-c
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu05140  Leishmaniasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14131 (Fcgr3)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14131 (Fcgr3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14131 (Fcgr3)
   05152 Tuberculosis
    14131 (Fcgr3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    14131 (Fcgr3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14131 (Fcgr3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14131 (Fcgr3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    14131 (Fcgr3)
CD molecules [BR:mmu04090]
 Proteins
  14131 (Fcgr3)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 Ig_5 I-set Lipocalin_5 TadE
Other DBs
NCBI-GeneID: 14131
NCBI-ProteinID: NP_001343440
MGI: 95500
Ensembl: ENSMUSG00000059498
Vega: OTTMUSG00000035155
Position
1 H3; 1 78.8 cM
AA seq 266 aa
MTLDTQMFQNAHSGSQWLLPPLTILLLFAFADRQSALPKAVVKLDPPWIQVLKEDMVTLM
CEGTHNPGNSSTQWFHNWSSIRSQVQSSYTFKATVNDSGEYRCQMEQTRLSDPVDLGVIS
DWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSH
SGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTAFSLVMCLLFAVDTGLYFYV
RRNLQTPRDYWRKSLSIRKHQAPQDK
NT seq 801 nt   +upstreamnt  +downstreamnt
atgactttggacacccagatgtttcagaatgcacactctggaagccaatggctacttcca
ccactgacaattctgctgctgtttgcttttgcagacaggcagagtgctcttccgaaggct
gtggtgaaactggaccccccatggatccaggtgctcaaggaagacatggtgacactgatg
tgcgaagggacccacaaccctgggaactcttctactcagtggttccacaactggagttcc
atccggagccaggtccaatccagctacacgtttaaggccacagtcaatgacagtggagaa
tatcggtgtcaaatggagcagacccgcctcagcgaccctgtagatctgggagtgatttct
gactggctgctgctccagacccctcagcgggtgtttctggaaggggaaaccatcacgcta
aggtgccatagctggaggaacaaactactgaacaggatctcgttcttccataatgaaaaa
tccgtgaggtatcatcactacaaaagtaatttctctatcccaaaagccaaccacagtcac
agtggggactactactgcaaaggaagtctaggaagtacacagcaccagtccaagcctgtc
accatcactgtccaagacccagcaactacatcctccatctctctagtctggtaccacact
gctttctccctagtgatgtgcctcctgtttgcagtggacacgggcctttatttctatgta
cggagaaatcttcaaaccccgagggattactggaggaagtccctgtcaatcagaaagcac
caggctcctcaagacaagtga

KEGG   Mus musculus (mouse): 246256
Entry
246256            CDS       T01002                                 

Gene name
Fcgr4, 4833442P21Rik, CD16-2, FcgRIV, Fcgam, FcgammaRIV, Fcgr, Fcgr3a, Fcrl3
Definition
(RefSeq) Fc receptor, IgG, low affinity IV
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04613  Neutrophil extracellular trap formation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04666  Fc gamma R-mediated phagocytosis
mmu05140  Leishmaniasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    246256 (Fcgr4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    246256 (Fcgr4)
   04650 Natural killer cell mediated cytotoxicity
    246256 (Fcgr4)
   04666 Fc gamma R-mediated phagocytosis
    246256 (Fcgr4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    246256 (Fcgr4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    246256 (Fcgr4)
   05152 Tuberculosis
    246256 (Fcgr4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    246256 (Fcgr4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    246256 (Fcgr4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    246256 (Fcgr4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    246256 (Fcgr4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    246256 (Fcgr4)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    246256 (Fcgr4)
CD molecules [BR:mmu04090]
 Proteins
  246256 (Fcgr4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  246256 (Fcgr4)
SSDB
Motif
Pfam: Ig_2 Ig_3 Ig_4 ig I-set V-set Ig_5 Ig_6 C1-set
Other DBs
NCBI-GeneID: 246256
NCBI-ProteinID: NP_653142
MGI: 2179523
Ensembl: ENSMUSG00000059089
Vega: OTTMUSG00000022168
UniProt: A0A0B4J1G0
Position
1 H3; 1 78.53 cM
AA seq 249 aa
MWQLLLPTALVLTAFSGIQAGLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWF
HNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEG
DPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNK
SSASFRISLGDPGSPSMFPPWHQITFCLLIGLLFAIDTVLYFSVRRGLQSPVADYEEPKI
QWSKEPQDK
NT seq 750 nt   +upstreamnt  +downstreamnt
atgtggcagctactactaccaacagctctggtacttacagctttctctggcattcaagct
ggtctccaaaaggctgtggtgaacctagaccccaagtgggtcagggtgcttgaggaagac
agcgtgaccctcagatgccaaggcactttctcccccgaggacaattctatcaagtggttc
cataacgaaagcctcatcccacaccaggatgccaactatgtcatccaaagtgccagagtt
aaggacagtggaatgtacaggtgccagacagccctctccacgatcagtgacccagtgcaa
ctagaggtccatatgggctggctattgcttcagaccactaagtggctgttccaggagggg
gaccccattcatctgagatgccacagttggcaaaacagacctgtacggaaggtcacctat
ttacagaacggcaaaggcaagaagtatttccatgaaaattctgaattactcattccaaaa
gctacacacaatgacagtggctcctacttctgcagagggctcattggacacaacaacaaa
tcttcagcatcctttcgtataagcctaggcgatccagggtctccatccatgtttccaccg
tggcatcaaatcacattctgcctgctgataggactcttgtttgcaatagacacagtgctg
tatttctctgtgcggaggggtcttcaaagtcctgtggctgactatgaggaacccaagatt
caatggagcaaggaacctcaggacaagtga

DBGET integrated database retrieval system