KEGG   Mus musculus (mouse): 14130
Entry
14130             CDS       T01002                                 

Gene name
Fcgr2b, AI528646, CD32, F630109E10Rik, Fc[g], Fc[g]RII, Fcg, FcgRII, Fcgamm, Fcgr, Fcgr2, Fcgr2a, Fcr-, Fcr-2, Fcr-3, Ly-1, Ly-17, Ly-m2, Ly-m20, LyM-, LyM-1, fcRII
Definition
(RefSeq) Fc receptor, IgG, low affinity IIb
  KO
K12560  low affinity immunoglobulin gamma Fc receptor II-b
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14130 (Fcgr2b)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    14130 (Fcgr2b)
   04666 Fc gamma R-mediated phagocytosis
    14130 (Fcgr2b)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14130 (Fcgr2b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    14130 (Fcgr2b)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14130 (Fcgr2b)
   05152 Tuberculosis
    14130 (Fcgr2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14130 (Fcgr2b)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14130 (Fcgr2b)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    14130 (Fcgr2b)
CD molecules [BR:mmu04090]
 Proteins
  14130 (Fcgr2b)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set Ig_5 Ig_4 C2-set DUF2613 DUF2973
Other DBs
NCBI-GeneID: 14130
NCBI-ProteinID: NP_034317
MGI: 95499
Ensembl: ENSMUSG00000026656
Vega: OTTMUSG00000021775
UniProt: P08101 A0A0B4J1G1
Position
1 H3; 1 78.02 cM
AA seq 293 aa
MGILPFLLIPMESNWTVHVFSRTLCHMLLWTAVLNLAAGTHDLPKAVVKLEPPWIQVLKE
DTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPV
DLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIP
KANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLPVLTIVAAVTGIAVAAIVIIL
VSLVYLKKKQVPDNPPDLEEAAKTEAENTITYSLLKHPEALDEETEHDYQNHI
NT seq 882 nt   +upstreamnt  +downstreamnt
atgggaatcctgccgttcctactgatccccatggagagcaactggactgtccatgtgttc
tcacggactttgtgccatatgctactgtggacagccgtgctaaatcttgctgctgggact
catgatcttccaaaggctgtggtcaaactcgagcccccgtggatccaggtgctcaaggaa
gacacggtgacactgacatgcgaagggacccacaaccctgggaactcttctacccagtgg
ttccacaatgggaggtccatccggagccaggtccaagccagctacacgtttaaggccaca
gtcaatgacagtggagaatatcggtgtcaaatggagcagacccgcctcagcgaccctgta
gatctgggagtgatttctgactggctgctgctccagacccctcagctggtgtttctggaa
ggggaaaccatcacgctaaggtgccatagctggaggaacaaactactgaacaggatctcg
ttcttccataatgaaaaatccgtgaggtatcatcactacagtagtaatttctctatccca
aaagccaaccacagtcacagtggggactactactgcaaaggaagtctaggaaggacactg
caccagtccaagcctgtcaccatcactgtccaagggcccaagtccagcaggtctttacca
gtattgacaattgtggctgctgtcactgggattgctgtcgcagccattgttattatccta
gtatccttggtctatctcaagaaaaagcaggttccagacaatcctcctgatctggaagaa
gctgccaaaactgaggctgagaatacgatcacctactcacttctcaagcatcccgaagcc
ctggatgaagaaacagagcatgattaccagaaccacatttag

DBGET integrated database retrieval system