KEGG   Mus musculus (mouse): 14131
Entry
14131             CDS       T01002                                 

Gene name
Fcgr3, CD16, Fcgam
Definition
(RefSeq) Fc receptor, IgG, low affinity III
  KO
K16824  low affinity immunoglobulin gamma Fc receptor II-c
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu05140  Leishmaniasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14131 (Fcgr3)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14131 (Fcgr3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14131 (Fcgr3)
   05152 Tuberculosis
    14131 (Fcgr3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    14131 (Fcgr3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    14131 (Fcgr3)
CD molecules [BR:mmu04090]
 Proteins
  14131 (Fcgr3)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 Ig_5 I-set TadE
Other DBs
NCBI-GeneID: 14131
NCBI-ProteinID: NP_001343440
MGI: 95500
Ensembl: ENSMUSG00000059498
Vega: OTTMUSG00000035155
Position
1 H3; 1 78.8 cM
AA seq 266 aa
MTLDTQMFQNAHSGSQWLLPPLTILLLFAFADRQSALPKAVVKLDPPWIQVLKEDMVTLM
CEGTHNPGNSSTQWFHNWSSIRSQVQSSYTFKATVNDSGEYRCQMEQTRLSDPVDLGVIS
DWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSH
SGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTAFSLVMCLLFAVDTGLYFYV
RRNLQTPRDYWRKSLSIRKHQAPQDK
NT seq 801 nt   +upstreamnt  +downstreamnt
atgactttggacacccagatgtttcagaatgcacactctggaagccaatggctacttcca
ccactgacaattctgctgctgtttgcttttgcagacaggcagagtgctcttccgaaggct
gtggtgaaactggaccccccatggatccaggtgctcaaggaagacatggtgacactgatg
tgcgaagggacccacaaccctgggaactcttctactcagtggttccacaactggagttcc
atccggagccaggtccaatccagctacacgtttaaggccacagtcaatgacagtggagaa
tatcggtgtcaaatggagcagacccgcctcagcgaccctgtagatctgggagtgatttct
gactggctgctgctccagacccctcagcgggtgtttctggaaggggaaaccatcacgcta
aggtgccatagctggaggaacaaactactgaacaggatctcgttcttccataatgaaaaa
tccgtgaggtatcatcactacaaaagtaatttctctatcccaaaagccaaccacagtcac
agtggggactactactgcaaaggaagtctaggaagtacacagcaccagtccaagcctgtc
accatcactgtccaagacccagcaactacatcctccatctctctagtctggtaccacact
gctttctccctagtgatgtgcctcctgtttgcagtggacacgggcctttatttctatgta
cggagaaatcttcaaaccccgagggattactggaggaagtccctgtcaatcagaaagcac
caggctcctcaagacaagtga

DBGET integrated database retrieval system