KEGG   Mus musculus (mouse): 14133Help
Entry
14133             CDS       T01002                                 

Gene name
Fcna, Fcn1
Definition
(RefSeq) ficolin A
  KO
K10104  ficolin
Organism
mmu  Mus musculus (mouse)
Brite
Lectins [BR:mmu04091]
 Ficolins
  14133 (Fcna)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C Collagen DAG_kinase_N
Motif
Other DBs
NCBI-GeneID: 14133
NCBI-ProteinID: NP_032021
MGI: 1340905
Ensembl: ENSMUSG00000026938
Vega: OTTMUSG00000012513
UniProt: O70165 Q4FJM1
Position
2; 2 A3
AA seq 334 aa AA seqDB search
MQWPTLWAFSGLLCLCPSQALGQERGACPDVKVVGLGAQDKVVVIQSCPGFPGPPGPKGE
PGSPAGRGERGFQGSPGKMGPAGSKGEPGTMGPPGVKGEKGDTGAAPSLGEKELGDTLCQ
RGPRSCKDLLTRGIFLTGWYTIHLPDCRPLTVLCDMDVDGGGWTVFQRRVDGSIDFFRDW
DSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSEEQEKY
KLTLGQFLEGTAGDSLTKHNNMSFTTHDQDNDANSMNCAALFHGAWWYHNCHQSNLNGRY
LSGSHESYADGINWGTGQGHHYSYKVAEMKIRAS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcctacgctgtgggccttttcaggactgctctgtctctgtccctcccaggcc
ctgggtcaggagagaggtgcctgtccagatgttaaggtcgtaggtctgggggcccaggac
aaggtggttgtcatccaaagttgccctggctttcctggcccacctgggcccaaaggggag
cctggaagccctgctggaagaggagaacggggctttcagggcagcccaggaaagatggga
cctgccggcagcaaaggagagccaggaaccatggggcccccgggagttaaaggggagaaa
ggcgatacaggagctgcgccatctctgggtgaaaaggagctgggagacaccctgtgccag
agaggaccccggagctgcaaagacttgctgacacggggcatcttcctgactggctggtac
accatccatcttcctgactgccggccactgactgtgctctgtgacatggatgtggacggt
gggggctggaccgtttttcaacgacgagtggacgggtctatcgatttcttccgagactgg
gactcctataaaagaggctttggcaacctgggcacggagttctggttgggtaatgactac
ctgcacctgctcacagccaatgggaaccaagagctccgagttgacttacaagatttccaa
gggaaaggctcctatgccaagtacagctcattccaggtatctgaagaacaggagaaatac
aagctgaccttggggcagtttctggagggcactgcaggagactccctgacaaagcacaac
aacatgtcatttacaacccatgaccaagataatgatgcaaatagcatgaactgtgcagct
ttgttccatggagcctggtggtaccacaactgccaccagtccaacctcaacgggcgctac
ttgtctggctcccatgagagttatgcggatggcatcaactggggaactggccaaggtcac
cactactcctacaaggttgccgagatgaaaatccgagcatcttaa

DBGET integrated database retrieval system