KEGG   Mus musculus (mouse): 14155Help
Entry
14155             CDS       T01002                                 

Gene name
Fem1b, mKIAA0396
Definition
(RefSeq) fem 1 homolog b
  KO
K10349  Fem-1 homolog b
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    14155 (Fem1b)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Target recognizing subunit (VHL box)
     14155 (Fem1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5
Motif
Other DBs
NCBI-GeneID: 14155
NCBI-ProteinID: NP_034323
MGI: 1335087
Ensembl: ENSMUSG00000032244
Vega: OTTMUSG00000062562
UniProt: Q9Z2G0
Position
9 B; 9 33.87 cM
AA seq 627 aa AA seqDB search
MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAK
VVRLLLEHYRVQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVT
NSTPLRAACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADP
NAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELLLS
HADCDRRSRIEALELLGASFANDRENYDIMKTYHYLYLAMLERFQDGDNILEKEVLPPIH
AYGNRTECRNPQELEAIRQDRDALHMEGLIVRERILGADNIDVSHPIIYRGAVYADNMEF
EQCIKLWLHALHLRQKGNRNTHKDLLRFAQVFSQMIHLNEAVKAPDIECVLRCSVLEIEQ
SMNRVKNISDADVHSAMDNYECNLYTFLYLVCISTKTQCSEEDQCRINKQIYNLIHLDPR
TREGFSLLHLAVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIV
QYNRPISDFLTLHSIIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCL
AARAVRANDINYQDQIPRTLEEFVGFH
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggagggcctggctggctatgtgtacaaggcggccagcgagggcaaggtgctcactctg
gctgccttgctccttaaccggtcagagagcgatatccgctacctgctgggctatgtcagt
cagcagggaggacagcgctccacacccctcatcatcgcagcccgcaatgggcacgccaag
gtggtgcgcttgctgttagaacactaccgtgtgcagacccagcagaccggcaccgtccgc
ttcgacgggtatgtcattgacggtgccactgctctttggtgtgctgcgggagccggacat
tttgaagttgttaaacttctagtcagccatggagccaacgtgaaccacaccacagtcact
aactcaactccattgcgggcagcatgctttgatggcagactggacattgtgaaatatttg
gttgaaaataatgccaatatcagcattgccaacaagtatgacaacacctgcctaatgatc
gcagcatataaagggcacactgatgtggtcagatacctcttagaacaacgtgctgatccc
aatgctaaagcacactgtggagccacagctttgcactttgcagccgaagctggtcacatt
gacattgtgaaagaactgataaaatggagagctgcaatagtggtgaatggccatgggatg
acaccattgaaggtggccgctgaaagctgtaaagctgatgtcgttgaactgttgctctct
catgctgattgtgaccgcagaagtcggattgaagccttggagctcttgggtgcctccttt
gcaaatgatcgtgagaactatgacatcatgaagacataccactatttatatttagctatg
ttggagagatttcaggatggtgacaacattcttgaaaaagaggttctcccacccatccat
gcttatgggaacagaactgagtgtaggaacccacaggaattggaggctattcggcaagac
agagatgctcttcacatggagggccttatagttcgggaacggattttaggtgctgacaac
attgatgtttcccaccccatcatttacagaggggctgtctatgctgataacatggagttc
gagcagtgcatcaaattgtggctccacgcactacacctgaggcagaaaggtaacaggaat
acccacaaagatctgcttcggtttgctcaagtcttctctcagatgatacacctcaatgaa
gctgtgaaggccccagacatagagtgcgttttgagatgcagtgtcttggaaatagagcag
agcatgaacagagttaaaaatatctccgatgccgacgtccacagtgccatggataactat
gagtgtaacctctatacctttctgtacctcgtgtgcatctccaccaagacacagtgtagc
gaagaagatcagtgcagaattaacaagcagatctacaacctgattcacctggaccccaga
acacgggaaggtttttccttgctacacctggctgtcaactcgaacacaccagttgatgat
ttccatactaacgatgtctgcagctttcccaacgctctggtcacaaagctcctgctggac
tgtggcgctgaggtaaatgcagtggacaatgaggggaacagtgccctccacattatcgtc
cagtacaacaggcccatcagtgattttctgaccttgcactccatcatcatcagccttgtg
gaggctggagctcacaccgacatgacaaacaagcagaataaaactccgctagacaaaagt
acaactggggtgtctgaaatactacttaaaactcagatgaagatgagcctcaagtgcctg
gctgcccgagcagttcgggctaatgacattaactaccaagaccagatcccccggactctt
gaagagtttgttggatttcattaa

DBGET integrated database retrieval system