KEGG   Mus musculus (house mouse): 14156
Entry
14156             CDS       T01002                                 
Symbol
Fen1, AW538437, FEN-1
Name
(RefSeq) flap structure specific endonuclease 1
  KO
K04799  flap endonuclease-1 [EC:3.1.-.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    14156 (Fen1)
   03410 Base excision repair
    14156 (Fen1)
   03450 Non-homologous end-joining
    14156 (Fen1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    14156 (Fen1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    14156 (Fen1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14156 (Fen1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     14156 (Fen1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    14156 (Fen1)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     14156 (Fen1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     14156 (Fen1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14156 (Fen1)
SSDB
Motif
Pfam: XPG_N XPG_I 5_3_exonuc DUF3560 HHH_5
Other DBs
NCBI-GeneID: 14156
NCBI-ProteinID: NP_001258543
MGI: 102779
Ensembl: ENSMUSG00000024742
UniProt: Q91Z50
Position
19:complement(10176496..10181757)
AA seq 380 aa
MGIHGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQEAGME
EEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALAKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRVLQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPSKYPVPENWLHKEAQQLFLEPEVLDPESVELKWSE
PNEEELVKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGPAKKKAKTGGAGKFRRGK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgggaattcacggccttgccaaactaattgctgatgtggcccccagtgccatccgtgag
aatgacatcaagagctactttggtcgcaaagtggccatcgatgcctccatgagcatctac
cagttcctgattgctgttcgtcagggtggggatgtgctgcagaacgaggagggtgagacc
accagccacctgatgggcatgttctaccgtaccatccgcatgatggagaatggcatcaag
cctgtgtacgtctttgatggcaaaccaccacagctgaagtcaggcgagctggccaagcgc
agtgagaggcgcgccgaggctgagaagcaactgcagcaggctcaggaggctgggatggag
gaggaggtggagaagttcaccaagaggctcgtgaaggtcaccaagcaacacaatgatgag
tgcaaacacctgctgagcctcatgggcatcccttaccttgatgcacccagcgaggcagag
gccagctgtgctgccctggcaaaggctggcaaagtctatgctgcggccacggaggacatg
gactgcctcacttttggcagccccgtgctaatgcgacacttaactgccagtgaggccaag
aagctgcccatccaagagttccatctgagccgcgtcctgcaggagctgggtctgaaccag
gagcagtttgtggatctgtgcatcctgctgggtagcgactactgcgagagcatccgtggc
attgggcccaagcgggctgtggatctcatccagaaacataagagcatcgaggagatcgtg
aggcggctggaccccagcaagtaccccgttccagagaactggctccacaaggaagcccag
cagctcttcctggagccagaagtactggacccagagtctgtggagctgaagtggagcgag
ccaaatgaagaagagttggtcaaatttatgtgtggtgaaaagcagttttctgaagagcga
attcgcagtggggtcaagcggctgagtaagagccgccagggcagcacccagggacgcctc
gatgatttcttcaaggtgacaggctcactctcctcagctaagcgcaaggagccagaaccc
aaggggcctgctaagaagaaagcaaagactgggggagcggggaagttccgaaggggaaaa
taa

DBGET integrated database retrieval system