KEGG   Mus musculus (mouse): 14164
Entry
14164             CDS       T01002                                 

Gene name
Fgf1, Dffrx, Fam, Fgf, Fgf-1, Fgf2b, Fgfa
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14164 (Fgf1)
   04014 Ras signaling pathway
    14164 (Fgf1)
   04015 Rap1 signaling pathway
    14164 (Fgf1)
   04390 Hippo signaling pathway
    14164 (Fgf1)
   04020 Calcium signaling pathway
    14164 (Fgf1)
   04151 PI3K-Akt signaling pathway
    14164 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14164 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14164 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    14164 (Fgf1)
   05218 Melanoma
    14164 (Fgf1)
   05224 Breast cancer
    14164 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14164 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14164 (Fgf1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14164 (Fgf1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14164 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 14164
NCBI-ProteinID: NP_034327
MGI: 95515
Ensembl: ENSMUSG00000036585
Vega: OTTMUSG00000020317
UniProt: P61148 Q6ZWS1
Position
18 B3; 18 20.74 cM
AA seq 155 aa
MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggagatcacaaccttcgcagccctgaccgagaggttcaacctgcctcta
ggaaactacaaaaagcccaaactgctctactgcagcaacgggggccacttcttgaggatc
cttcctgatggcaccgtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagtgcgggcgaagtgtatataaagggtacggagaccggccagtacttg
gccatggacaccgaagggcttttatacggctcgcagacaccaaatgaggaatgtctgttc
ctggaaaggctggaagaaaaccattataacacttacacctccaagaagcatgcggagaag
aactggtttgtgggcctcaagaagaacgggagctgtaagcgcggtcctcggactcactat
ggccagaaagccatcttgtttctgcccctcccggtgtcttctgactag

KEGG   Mus musculus (mouse): 14165
Entry
14165             CDS       T01002                                 

Gene name
Fgf10, AEY1, AEY17, BB213776, Fgf-10, Fgf5a, Gsfaey, Gsfaey17
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14165 (Fgf10)
   04014 Ras signaling pathway
    14165 (Fgf10)
   04015 Rap1 signaling pathway
    14165 (Fgf10)
   04020 Calcium signaling pathway
    14165 (Fgf10)
   04151 PI3K-Akt signaling pathway
    14165 (Fgf10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14165 (Fgf10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14165 (Fgf10)
  09162 Cancer: specific types
   05226 Gastric cancer
    14165 (Fgf10)
   05218 Melanoma
    14165 (Fgf10)
   05224 Breast cancer
    14165 (Fgf10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14165 (Fgf10)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14165 (Fgf10)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14165 (Fgf10)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14165 (Fgf10)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 14165
NCBI-ProteinID: NP_032028
MGI: 1099809
Ensembl: ENSMUSG00000021732
Vega: OTTMUSG00000032890
UniProt: O35565
Position
13 D2.3; 13 67.14 cM
AA seq 209 aa
MWKWILTHCASAFPHLPGCCCCFLLLFLVSSFPVTCQALGQDMVSQEATNCSSSSSSFSS
PSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIG
VVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVA
LNGKGAPRRGQKTRRKNTSAHFLPMTIQT
NT seq 630 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgccgggctgctgt
tgctgcttcttgttgctctttttggtgtcttcgttccctgtcacctgccaagctcttggt
caggacatggtgtcacaggaggccaccaactgctcttcttcctcctcgtccttctcctct
ccttccagtgcgggaaggcatgtgcggagctacaatcacctccaaggagatgtccgctgg
agaaggctgttctccttcaccaagtactttctcacgattgagaagaacggcaaggtcagc
gggaccaagaatgaagactgtccgtacagtgtcctggagataacatcagtggaaatcgga
gttgttgccgtcaaagccatcaacagcaactattacttagccatgaacaagaaggggaaa
ctctatggctcaaaagagtttaacaacgactgtaagctgaaagagagaatagaggaaaat
ggatacaacacctatgcatcttttaactggcagcacaatggcaggcaaatgtatgtggca
ttgaatggaaaaggagctcccaggagaggacaaaaaacaagaaggaaaaacacctctgct
cacttcctccccatgacgatccaaacatag

KEGG   Mus musculus (mouse): 14170
Entry
14170             CDS       T01002                                 

Gene name
Fgf15, FGF19, Fgf8a
Definition
(RefSeq) fibroblast growth factor 15
  KO
K22603  fibroblast growth factor 19
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14170 (Fgf15)
   04014 Ras signaling pathway
    14170 (Fgf15)
   04015 Rap1 signaling pathway
    14170 (Fgf15)
   04020 Calcium signaling pathway
    14170 (Fgf15)
   04151 PI3K-Akt signaling pathway
    14170 (Fgf15)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14170 (Fgf15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14170 (Fgf15)
  09162 Cancer: specific types
   05226 Gastric cancer
    14170 (Fgf15)
   05218 Melanoma
    14170 (Fgf15)
   05224 Breast cancer
    14170 (Fgf15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14170 (Fgf15)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14170 (Fgf15)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14170 (Fgf15)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14170 (Fgf15)
SSDB
Motif
Pfam: FGF Fascin DUF3458
Other DBs
NCBI-GeneID: 14170
NCBI-ProteinID: NP_032029
MGI: 1096383
Ensembl: ENSMUSG00000031073
Vega: OTTMUSG00000059889
UniProt: O35622 Q790L8
Position
7; 7 F5
AA seq 218 aa
MARKWNGRAVARALVLATLWLAVSGRPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGP
YVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLI
RYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFET
GDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcgagaaagtggaacgggcgtgcggtggcccgagccctggtcctggccactctgtgg
ctggctgtgtctgggcgtcccctggctcagcaatcccagtctgtgtcagatgaagatcca
ctctttctctacggctggggcaagattacccgcctgcagtacctgtactccgctggtccc
tatgtctccaactgcttcctccgaatccggagcgacggctctgtggactgcgaggaggac
caaaacgaacgaaatttgttggaattccgcgcggtcgctctgaagacgattgccatcaag
gacgtcagcagcgtgcggtacctctgcatgagcgcggacggcaagatatacgggctgatt
cgctactcggaggaagactgtaccttcagggaggaaatggactgtttaggctacaaccag
tacagatccatgaagcaccatctccatatcatcttcatccaggccaagcccagagaacag
ctccaggaccagaaaccctcaaactttatccccgtgtttcaccgctccttctttgaaacc
ggggaccagctgaggtctaaaatgttctccctgcccctggagagtgacagcatggatccg
ttcaggatggtggaggatgtagaccacctagtgaagagtcccagcttccagaaatga

KEGG   Mus musculus (mouse): 14171
Entry
14171             CDS       T01002                                 

Gene name
Fgf17, Fgf6b
Definition
(RefSeq) fibroblast growth factor 17
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14171 (Fgf17)
   04014 Ras signaling pathway
    14171 (Fgf17)
   04015 Rap1 signaling pathway
    14171 (Fgf17)
   04020 Calcium signaling pathway
    14171 (Fgf17)
   04151 PI3K-Akt signaling pathway
    14171 (Fgf17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14171 (Fgf17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14171 (Fgf17)
  09162 Cancer: specific types
   05226 Gastric cancer
    14171 (Fgf17)
   05218 Melanoma
    14171 (Fgf17)
   05224 Breast cancer
    14171 (Fgf17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14171 (Fgf17)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14171 (Fgf17)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14171 (Fgf17)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14171 (Fgf17)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 14171
NCBI-ProteinID: NP_032030
MGI: 1202401
Ensembl: ENSMUSG00000022101
UniProt: P63075 Q0VF19
Position
14 D2; 14 36.4 cM
AA seq 216 aa
MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggagccgcccgcctgctgcctaaccttaccctgtgcttgcagctattgattctctgc
tgtcaaacacagggggagaatcacccgtctcctaattttaaccagtacgtgagggaccag
ggcgctatgaccgaccagctgagcaggcggcaaatccgtgaataccagctctacagccgg
accagtggcaagcacgtgcaggtcaccggacgtcgcatctctgccaccgcagaggatggc
aacaagttcgccaagctcatcgtggagacagatacattcggcagcagagtccgcatcaag
ggggcagagagcgagaagtacatctgtatgaacaagaggggcaagctgattgggaagccg
agcgggaagagcaaagactgcgtgttcaccgagatcgtactggagaacaactacacggcc
ttccagaacgcccggcacgagggctggttcatggctttcactcggcagggccggccacgc
caggcctcccggagccgccagaaccagcgagaggcccacttcatcaagcgcctctaccaa
ggccagctgccttttcccaaccacgctgaaaggcagaagcagttcgaatttgtgggctcc
gcccccactcgcaggaccaagcgcactcggaggccccagtcccaaacgtag

KEGG   Mus musculus (mouse): 14172
Entry
14172             CDS       T01002                                 

Gene name
Fgf18, D130055P09Rik, FGF-18, Fgf6a
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14172 (Fgf18)
   04014 Ras signaling pathway
    14172 (Fgf18)
   04015 Rap1 signaling pathway
    14172 (Fgf18)
   04020 Calcium signaling pathway
    14172 (Fgf18)
   04151 PI3K-Akt signaling pathway
    14172 (Fgf18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14172 (Fgf18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14172 (Fgf18)
  09162 Cancer: specific types
   05226 Gastric cancer
    14172 (Fgf18)
   05218 Melanoma
    14172 (Fgf18)
   05224 Breast cancer
    14172 (Fgf18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14172 (Fgf18)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14172 (Fgf18)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14172 (Fgf18)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14172 (Fgf18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14172
NCBI-ProteinID: NP_032031
MGI: 1277980
Ensembl: ENSMUSG00000057967
Vega: OTTMUSG00000005390
UniProt: O89101
Position
11; 11 A4
AA seq 207 aa
MYSAPSACTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQAELQKPFKYTTVTKRSRRIRPTHPG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacactttctactgctgtgcttc
caggttcaggtgttggcagccgaggagaatgtggacttccgcatccacgtggagaaccag
acgcgggctcgagatgatgtgagtcggaagcagctgcgcttgtaccagctctatagcagg
accagtgggaagcacattcaagtcctgggccgtaggatcagtgcccgtggcgaggacggg
gacaagtatgcccagctcctagtggagacagataccttcgggagtcaagtccggatcaag
ggcaaggagacagaattctacctgtgtatgaaccgaaaaggcaagctcgtggggaagcct
gatggtactagcaaggagtgcgtgttcattgagaaggttctggaaaacaactacacggcc
ctgatgtctgccaagtactctggttggtatgtgggcttcaccaagaaggggcggcctcgc
aagggtcccaagacccgcgagaaccagcaagatgtacacttcatgaagcgttaccccaag
ggacaggccgagctgcagaagcccttcaaatacaccacagtcaccaagcgatcccggcgg
atccgccccactcaccccggctag

KEGG   Mus musculus (mouse): 14173
Entry
14173             CDS       T01002                                 

Gene name
Fgf2, Fgf-2, Fgf2a, Fgfb, bFGF
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14173 (Fgf2)
   04014 Ras signaling pathway
    14173 (Fgf2)
   04015 Rap1 signaling pathway
    14173 (Fgf2)
   04020 Calcium signaling pathway
    14173 (Fgf2)
   04151 PI3K-Akt signaling pathway
    14173 (Fgf2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14173 (Fgf2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14173 (Fgf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14173 (Fgf2)
   05205 Proteoglycans in cancer
    14173 (Fgf2)
  09162 Cancer: specific types
   05226 Gastric cancer
    14173 (Fgf2)
   05218 Melanoma
    14173 (Fgf2)
   05224 Breast cancer
    14173 (Fgf2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    14173 (Fgf2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14173 (Fgf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14173 (Fgf2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14173 (Fgf2)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14173 (Fgf2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14173 (Fgf2)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 14173
NCBI-ProteinID: NP_032032
MGI: 95516
Ensembl: ENSMUSG00000037225
Vega: OTTMUSG00000007393
UniProt: P15655 Q541T2
Position
3 B; 3 18.41 cM
AA seq 154 aa
MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVK
LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYS
SWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 465 nt   +upstreamnt  +downstreamnt
atggctgccagcggcatcacctcgcttcccgcactgccggaggacggcggcgccgccttc
ccaccaggccacttcaaggaccccaagcggctctactgcaagaacggcggcttcttcctg
cgcatccatcccgacggccgcgtggatggcgtccgcgagaagagcgacccacacgtcaaa
ctacaactccaagcagaagagagaggagttgtgtctatcaagggagtgtgtgccaaccgg
taccttgctatgaaggaagatggacggctgctggcttctaagtgtgttacagaagagtgt
ttcttctttgaacgactggaatctaataactacaatacttaccggtcacggaaatactcc
agttggtatgtggcactgaaacgaactgggcagtataaactcggatccaaaacgggacct
ggacagaaggccatactgtttcttccaatgtctgctaagagctga

KEGG   Mus musculus (mouse): 14174
Entry
14174             CDS       T01002                                 

Gene name
Fgf3, Fgf-3, Fgf5c, In, Int, Int-2, Int-P
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14174 (Fgf3)
   04014 Ras signaling pathway
    14174 (Fgf3)
   04015 Rap1 signaling pathway
    14174 (Fgf3)
   04020 Calcium signaling pathway
    14174 (Fgf3)
   04151 PI3K-Akt signaling pathway
    14174 (Fgf3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14174 (Fgf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14174 (Fgf3)
  09162 Cancer: specific types
   05226 Gastric cancer
    14174 (Fgf3)
   05218 Melanoma
    14174 (Fgf3)
   05224 Breast cancer
    14174 (Fgf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14174 (Fgf3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14174 (Fgf3)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14174 (Fgf3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14174 (Fgf3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14174
NCBI-ProteinID: NP_032033
MGI: 95517
Ensembl: ENSMUSG00000031074
Vega: OTTMUSG00000031027
UniProt: Q0VG15
Position
7 F5; 7 88.85 cM
AA seq 245 aa
MGLIWLLLLSLLEPSWPTTGPGTRLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGVVAIKGLFSGRYLAMNKRGRLYASDHYNAECEFVER
IHELGYNTYASRLYRTGSSGPGAQRQPGAQRPWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLGHKDHEMVRLLQSSQPRAPGEGSQPRQRRQKKQSPSDHGKMETLSTRATPSTQLHTG
GLAVA
NT seq 738 nt   +upstreamnt  +downstreamnt
atgggcctgatctggcttctgctgctcagcttgctggaacccagctggccaactacgggg
cccgggacgcgactacgacgcgatgcgggcggccgtggtggcgtttacgagcacctcggc
ggggcgccacggcgccgcaagctctactgcgctaccaagtaccacctccagctgcaccca
agcggccgcgtgaacggcagccttgagaacagcgcctatagcatcctggagattactgcg
gtggaagtgggcgtggtggccatcaaagggctcttttctgggcggtacctggccatgaac
aagagaggacggctgtatgcttcggatcactacaacgcagagtgtgagtttgtggaacgg
atccatgagctgggctacaatacatatgcttcccgcctgtaccgcacagggtccagtggg
ccaggagctcaacggcaacctggtgcccagagaccttggtacgtgtcggtgaatggcaag
ggtcggccacgcaggggcttcaagacccgccgcacacaaaagtcctctctcttcctgccc
cgagtgctgggccacaaggaccatgagatggtgcggctgctgcagagtagccagccacga
gccccaggagagggcagccagcccaggcagcggaggcagaagaagcagagcccaagtgat
catggcaagatggagactttgtctaccagggccactccaagcacccagctgcatacaggt
ggactggctgtggcctga

KEGG   Mus musculus (mouse): 14175
Entry
14175             CDS       T01002                                 

Gene name
Fgf4, Fgf-4, Fgf7a, Fgfk, HBGF-4, Hst1, Hstf-, Hstf-1, KS3, hst, hst-1, kFGF
Definition
(RefSeq) fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14175 (Fgf4)
   04014 Ras signaling pathway
    14175 (Fgf4)
   04015 Rap1 signaling pathway
    14175 (Fgf4)
   04020 Calcium signaling pathway
    14175 (Fgf4)
   04151 PI3K-Akt signaling pathway
    14175 (Fgf4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14175 (Fgf4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14175 (Fgf4)
  09162 Cancer: specific types
   05226 Gastric cancer
    14175 (Fgf4)
   05218 Melanoma
    14175 (Fgf4)
   05224 Breast cancer
    14175 (Fgf4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14175 (Fgf4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14175 (Fgf4)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14175 (Fgf4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14175 (Fgf4)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14175
NCBI-ProteinID: NP_034332
MGI: 95518
Ensembl: ENSMUSG00000050917
Vega: OTTMUSG00000059887
UniProt: P11403
Position
7 F5; 7 88.88 cM
AA seq 202 aa
MAKRGPTTGTLLPRVLLALVVALADRGTAAPNGTRHAELGHGWDGLVARSLARLPVAAQP
PQAAVRSGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRG
VVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKN
GRTKKGNRVSPTMKVTHFLPRL
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcgaaacgcgggccgaccacagggacgctgctgcccagggtcctgctggccctggtg
gtggccctggcggaccgagggaccgccgcacccaacggcacgcggcacgcagaattgggg
cacggctgggacggcttggtggcccgctcgctggcacgcctgccggtggccgcgcagccc
ccgcaggcggcggtccgcagcggcgcaggggactacctgctgggcctcaaaaggcttcgg
cggctctactgcaacgtgggcatcggattccacctgcaggtgctgcccgacggccgcatc
ggtggtgtgcacgcagacacgagggacagtcttctggagctctctccggtgcagcgaggc
gtggtgagcatcttcggagtggccagccggttcttcgtggccatgagcagcaggggcaag
ctcttcggtgtgcctttctttaccgacgagtgtaaattcaaagaaatacttctgcccaac
aactacaacgcctacgaatcctacgcgtaccccggtatgttcatggccctcagtaagaac
gggcggaccaagaaggggaaccgagtgtcgcctaccatgaaggtaacccacttccttcct
agactgtga

KEGG   Mus musculus (mouse): 14176
Entry
14176             CDS       T01002                                 

Gene name
Fgf5, Fgf-5, Fgf3a, HBGF-5, angora, go
Definition
(RefSeq) fibroblast growth factor 5
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14176 (Fgf5)
   04014 Ras signaling pathway
    14176 (Fgf5)
   04015 Rap1 signaling pathway
    14176 (Fgf5)
   04020 Calcium signaling pathway
    14176 (Fgf5)
   04151 PI3K-Akt signaling pathway
    14176 (Fgf5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14176 (Fgf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14176 (Fgf5)
  09162 Cancer: specific types
   05226 Gastric cancer
    14176 (Fgf5)
   05218 Melanoma
    14176 (Fgf5)
   05224 Breast cancer
    14176 (Fgf5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14176 (Fgf5)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14176 (Fgf5)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14176 (Fgf5)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14176 (Fgf5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14176
NCBI-ProteinID: NP_034333
MGI: 95519
Ensembl: ENSMUSG00000029337
Vega: OTTMUSG00000053547
UniProt: P15656
Position
5 E3; 5 47.77 cM
AA seq 264 aa
MSLSLLFLIFCSHLIHSAWAHGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFSSSSASSP
VAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILE
IFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTE
KTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPVK
PKVPLSQPRRSPSPVKYRLKFRFG
NT seq 795 nt   +upstreamnt  +downstreamnt
atgagcctgtccttgctcttcctcatcttctgcagccacctgatccacagcgcttgggct
cacggggagaagcgtctcactcccgaagggcaacccgcgcctcctaggaacccgggagac
tccagcggcagccggggcagaagtagcgcgacgttttcttcgtcttctgcctcctcacca
gtcgcagcttctccgggcagccaaggaagcggctcggaacatagcagtttccagtggagc
ccttcggggcgccggaccggcagcctgtactgcagagtgggcatcggtttccatctgcag
atctacccggatggcaaagtcaatggctcccacgaagccagtgtgttaagtattttggaa
atatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaattttta
gcgatgtcaaaaaaaggaaaactccatgcaagtgccaaatttacggatgactgtaagttc
agggagagattccaagaaaacagctataatacctatgcgtccgcgatccacagaactgaa
aagacaggccgagagtggtacgtggccctgaacaagagagggaaagccaagagaggctgc
agcccacgggtcaaaccccaacacgtctccacccacttcctacccaggttcaagcagtcc
gagcaaccggaactttccttcaccgtcactgttccagaaaagaaaaagccaccggtgaaa
ccaaaggtgcccctgtcgcagcctcgcagaagtcccagcccagtgaagtacagactgaag
tttcgctttggatga

KEGG   Mus musculus (mouse): 14177
Entry
14177             CDS       T01002                                 

Gene name
Fgf6, Fgf-6, Fgf7b, HSTF-2
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14177 (Fgf6)
   04014 Ras signaling pathway
    14177 (Fgf6)
   04015 Rap1 signaling pathway
    14177 (Fgf6)
   04020 Calcium signaling pathway
    14177 (Fgf6)
   04151 PI3K-Akt signaling pathway
    14177 (Fgf6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14177 (Fgf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14177 (Fgf6)
  09162 Cancer: specific types
   05226 Gastric cancer
    14177 (Fgf6)
   05218 Melanoma
    14177 (Fgf6)
   05224 Breast cancer
    14177 (Fgf6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14177 (Fgf6)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14177 (Fgf6)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14177 (Fgf6)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14177 (Fgf6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14177
NCBI-ProteinID: NP_034334
MGI: 95520
Ensembl: ENSMUSG00000000183
Vega: OTTMUSG00000056342
UniProt: P21658 Q8C399
Position
6 F3; 6 61.92 cM
AA seq 208 aa
MALGQRLFITMSRGAGRVQGTLQALVFLGVLVGMVVPSPAGARANGTLLDSRGWGTLLSR
SRAGLAGEISGVNWESGYLVGIKRQRRLYCNVGIGFHLQVPPDGRISGTHEENPYSLLEI
STVERGVVSLFGVKSALFIAMNSKGRLYTTPSFHDECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtcccggggagcaggacgtgttcagggc
acgctgcaggctctcgtcttcttaggcgtcctagtgggcatggtggtgccctcacctgcc
ggcgcccgcgccaacggcacgctactggactccagaggctggggcaccctcttgtccagg
tctcgagctgggctagctggagagatttcgggtgtgaattgggaaagcggctatttggtg
ggcattaagcgacagcggagactctactgcaacgtgggcattggcttccacctccaggtg
cctcctgacggccgcatcagtggaacacacgaggagaacccctacagcctgctggagatc
tccacggtagaacggggtgtggtgagcctcttcggggtgaagagtgctctcttcattgcc
atgaacagtaaaggaagactgtacacaacgcccagcttccacgacgaatgcaagttccga
gaaaccctccttccaaacaactacaacgcctacgagtcagacctgtacagagggacctac
attgcactgagcaaatatggacgggtaaagcggggcagcaaggtgtccccaatcatgact
gtcactcacttcctccccaggatataa

KEGG   Mus musculus (mouse): 14178
Entry
14178             CDS       T01002                                 

Gene name
Fgf7, Fgf5b, Kgf
Definition
(RefSeq) fibroblast growth factor 7
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14178 (Fgf7)
   04014 Ras signaling pathway
    14178 (Fgf7)
   04015 Rap1 signaling pathway
    14178 (Fgf7)
   04020 Calcium signaling pathway
    14178 (Fgf7)
   04151 PI3K-Akt signaling pathway
    14178 (Fgf7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14178 (Fgf7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14178 (Fgf7)
  09162 Cancer: specific types
   05226 Gastric cancer
    14178 (Fgf7)
   05218 Melanoma
    14178 (Fgf7)
   05224 Breast cancer
    14178 (Fgf7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14178 (Fgf7)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14178 (Fgf7)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14178 (Fgf7)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14178 (Fgf7)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 14178
NCBI-ProteinID: NP_032034
MGI: 95521
Ensembl: ENSMUSG00000027208
Vega: OTTMUSG00000015341
UniProt: P36363 Q544I6
Position
2; 2 F1
AA seq 194 aa
MRKWILTRILPTLLYRSCFHLVCLVGTISLACNDMSPEQTATSVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcgcaaatggatactgacacggatcctgccaactctgctctacagatcatgcttccac
ctcgtctgtctagtgggcactatatctctagcttgcaatgacatgagtccggagcaaacg
gctacgagtgtgaactgttccagccccgagcgacacaccagaagttatgactacatggaa
ggaggggatataagggtgagaagactgttctgtcgcacccagtggtacctgaggattgac
aaacgaggcaaagtgaaagggacccaggagatgaagaacagctacaacatcatggaaatc
aggaccgtggcagttggaattgtggcaatcaaaggggtggaaagtgaatactatcttgcc
atgaacaaggaagggaaactctatgcaaagaaagaatgcaatgaggattgcaacttcaaa
gaactgattctggaaaaccattataacacctatgcatcagctaaatggacacacagcgga
ggggaaatgttcgttgccttaaatcaaaaggggattcctgtcaaagggaagaaaacgaag
aaagaacaaaaaacagcccattttcttcctatggcaataacctaa

KEGG   Mus musculus (mouse): 14179
Entry
14179             CDS       T01002                                 

Gene name
Fgf8, Ai, Aigf, Fgf-8, Fgf6c
Definition
(RefSeq) fibroblast growth factor 8
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14179 (Fgf8)
   04014 Ras signaling pathway
    14179 (Fgf8)
   04015 Rap1 signaling pathway
    14179 (Fgf8)
   04020 Calcium signaling pathway
    14179 (Fgf8)
   04151 PI3K-Akt signaling pathway
    14179 (Fgf8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14179 (Fgf8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14179 (Fgf8)
  09162 Cancer: specific types
   05226 Gastric cancer
    14179 (Fgf8)
   05218 Melanoma
    14179 (Fgf8)
   05224 Breast cancer
    14179 (Fgf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14179 (Fgf8)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14179 (Fgf8)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14179 (Fgf8)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14179 (Fgf8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 14179
NCBI-ProteinID: NP_034335
MGI: 99604
Ensembl: ENSMUSG00000025219
Vega: OTTMUSG00000021697
UniProt: P37237 Q80ZL6
Position
19 C3; 19 38.75 cM
AA seq 268 aa
MGSPRSALSCLLLHLLVLCLQAQVRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKN
FTNPAPNYPEEGSKEQRDSVLPKVTQRHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQV
LANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDC
VFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQ
SLRFEFLNYPPFTRSLRGSQRTWAPEPR
NT seq 807 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctgttgcacttgctggttctctgcctc
caagcccaggtaaggagcgctgcgcagaagcgggggccgggcgcggggaacccagctgac
actctcgggcagggacacgaggaccgacccttcggccagcgcagcagggctggaaagaac
tttacaaatccagccccaaactaccccgaggagggatctaaggaacagagagacagtgtc
ctgcctaaagtcacacagcgacatgtgagggagcagagcctggtgacggatcagctcagc
cgccgcctcatccggacctaccagctctacagccgcaccagcgggaagcacgtgcaggtc
ctggccaacaagcgcatcaacgccatggcagaagacggagaccccttcgcgaagctcatt
gtggagaccgatacttttggaagcagagtccgagttcgcggcgcagagacaggtctctac
atctgcatgaacaagaaggggaagctaattgccaagagcaacggcaaaggcaaggactgc
gtattcacagagatcgtgctggagaacaactacacggcgctgcagaacgccaagtacgag
ggctggtacatggcctttacccgcaagggccggccccgcaagggctccaagacgcgccag
catcagcgcgaggtgcacttcatgaagcgcctgccgcggggccaccacaccaccgagcag
agcctgcgcttcgagttcctcaactacccgcccttcacgcgcagcctgcgcggcagccag
aggacttgggccccggagccccgatag

KEGG   Mus musculus (mouse): 14180
Entry
14180             CDS       T01002                                 

Gene name
Fgf9, Ek, Eks, Fgf4b
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14180 (Fgf9)
   04014 Ras signaling pathway
    14180 (Fgf9)
   04015 Rap1 signaling pathway
    14180 (Fgf9)
   04020 Calcium signaling pathway
    14180 (Fgf9)
   04151 PI3K-Akt signaling pathway
    14180 (Fgf9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14180 (Fgf9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14180 (Fgf9)
  09162 Cancer: specific types
   05226 Gastric cancer
    14180 (Fgf9)
   05218 Melanoma
    14180 (Fgf9)
   05224 Breast cancer
    14180 (Fgf9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14180 (Fgf9)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14180 (Fgf9)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14180 (Fgf9)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14180 (Fgf9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14180
NCBI-ProteinID: NP_038546
MGI: 104723
Ensembl: ENSMUSG00000021974
Vega: OTTMUSG00000036883
UniProt: P54130
Position
14 C3; 14 30.51 cM
AA seq 208 aa
MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggagctatttcggtgtgcaggacgcggtaccgttcggg
aacgtaccggtgttgccggtggacagtccggtgttgctaagtgaccacctgggtcagtcc
gaagcaggggggctgccccggggccccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctgtactgcaggactggatttcatttagagatcttccccaacggt
actatccagggaaccaggaaagaccacagccgcttcggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgcggtgtggacagtggactctacctcggcatgaacgag
aagggggagctgtatggatcagaaaaactaacacaggaatgtgtgttcagagaacagttt
gaagagaactggtacaacacctactcttccaacctctataaacatgtggacaccggaagg
agatactatgttgcattaaataaggacgggactccaagagaagggaccaggactaaacgg
caccagaaatttacacattttttacctagaccagtggaccctgacaaagtacctgaacta
tataaggatattctaagccaaagctga

KEGG   Mus musculus (mouse): 56636
Entry
56636             CDS       T01002                                 

Gene name
Fgf21, Fgf8c
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04714  Thermogenesis
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    56636 (Fgf21)
   04014 Ras signaling pathway
    56636 (Fgf21)
   04015 Rap1 signaling pathway
    56636 (Fgf21)
   04020 Calcium signaling pathway
    56636 (Fgf21)
   04151 PI3K-Akt signaling pathway
    56636 (Fgf21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    56636 (Fgf21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    56636 (Fgf21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56636 (Fgf21)
  09162 Cancer: specific types
   05226 Gastric cancer
    56636 (Fgf21)
   05218 Melanoma
    56636 (Fgf21)
   05224 Breast cancer
    56636 (Fgf21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    56636 (Fgf21)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    56636 (Fgf21)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   56636 (Fgf21)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   56636 (Fgf21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 56636
NCBI-ProteinID: NP_064397
MGI: 1861377
Ensembl: ENSMUSG00000030827
Vega: OTTMUSG00000058294
UniProt: Q9JJN1
Position
7; 7 B3
AA seq 210 aa
MEWMRSRVGTLGLWVRLLLAVFLLGVYQAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEA
HLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPE
ACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAG
FLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggaatggatgagatctagagttgggaccctgggactgtgggtccgactgctgctggct
gtcttcctgctgggggtctaccaagcataccccatccctgactccagccccctcctccag
tttgggggtcaagtccggcagaggtacctctacacagatgacgaccaagacactgaagcc
cacctggagatcagggaggatggaacagtggtaggcgcagcacaccgcagtccagaaagt
ctcctggagctcaaagccttgaagccaggggtcattcaaatcctgggtgtcaaagcctct
aggtttctttgccaacagccagatggagctctctatggatcgcctcactttgatcctgag
gcctgcagcttcagagaactgctgctggaggacggttacaatgtgtaccagtctgaagcc
catggcctgcccctgcgtctgcctcagaaggactccccaaaccaggatgcaacatcctgg
ggacctgtgcgcttcctgcccatgccaggcctgctccacgagccccaagaccaagcagga
ttcctgcccccagagcccccagatgtgggctcctctgaccccctgagcatggtagagcct
ttacagggccgaagccccagctatgcgtcctga

KEGG   Mus musculus (mouse): 64654
Entry
64654             CDS       T01002                                 

Gene name
Fgf23, Fgf8b
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    64654 (Fgf23)
   04014 Ras signaling pathway
    64654 (Fgf23)
   04015 Rap1 signaling pathway
    64654 (Fgf23)
   04020 Calcium signaling pathway
    64654 (Fgf23)
   04151 PI3K-Akt signaling pathway
    64654 (Fgf23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    64654 (Fgf23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    64654 (Fgf23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64654 (Fgf23)
  09162 Cancer: specific types
   05226 Gastric cancer
    64654 (Fgf23)
   05218 Melanoma
    64654 (Fgf23)
   05224 Breast cancer
    64654 (Fgf23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    64654 (Fgf23)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    64654 (Fgf23)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   64654 (Fgf23)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   64654 (Fgf23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 64654
NCBI-ProteinID: NP_073148
MGI: 1891427
Ensembl: ENSMUSG00000000182
Vega: OTTMUSG00000056344
UniProt: Q9EPC2 Q3U1V5
Position
6; 6 F3
AA seq 251 aa
MLGTCLRLLVGVLCTVCSLGTARAYPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGH
VDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTL
ENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTRS
AEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGG
ADRCRPFPRFV
NT seq 756 nt   +upstreamnt  +downstreamnt
atgctagggacctgccttagactcctggtgggcgtgctctgcactgtctgcagcttgggc
actgctagagcctatccggacacttccccattgcttggctccaactggggaagcctgacc
cacctgtacacggctacagccaggaccagctatcacctacagatccatagggatggtcat
gtagatggcaccccccatcagaccatctacagtgccctgatgattacatcagaggacgcc
ggctctgtggtgataacaggagccatgactcgaaggttcctttgtatggatctccacggc
aacatttttggatcgcttcacttcagcccagagaattgcaagttccgccagtggacgctg
gagaatggctatgacgtctacttgtcgcagaagcatcactacctggtgagcctgggccgc
gccaagcgcatcttccagccgggcaccaacccgccgcccttctcccagttcctggctcgc
aggaacgaggtcccgctgctgcatttctacactgttcgcccacggcgccacacgcgcagc
gccgaggacccaccggagcgcgacccactgaacgtgctcaagccgcggccccgcgccacg
cctgtgcctgtatcctgctctcgcgagctgccgagcgcagaggaaggtggccccgcagcc
agcgatcctctgggggtgctgcgcagaggccgtggagatgctcgcgggggcgcgggaggc
gcggataggtgtcgcccctttcccaggttcgtctag

KEGG   Mus musculus (mouse): 67112
Entry
67112             CDS       T01002                                 

Gene name
Fgf22, 2210414E06Rik, FGF-22, Fgf5d
Definition
(RefSeq) fibroblast growth factor 22
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    67112 (Fgf22)
   04014 Ras signaling pathway
    67112 (Fgf22)
   04015 Rap1 signaling pathway
    67112 (Fgf22)
   04020 Calcium signaling pathway
    67112 (Fgf22)
   04151 PI3K-Akt signaling pathway
    67112 (Fgf22)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    67112 (Fgf22)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    67112 (Fgf22)
  09162 Cancer: specific types
   05226 Gastric cancer
    67112 (Fgf22)
   05218 Melanoma
    67112 (Fgf22)
   05224 Breast cancer
    67112 (Fgf22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    67112 (Fgf22)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    67112 (Fgf22)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   67112 (Fgf22)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   67112 (Fgf22)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 67112
NCBI-ProteinID: NP_075793
MGI: 1914362
Ensembl: ENSMUSG00000020327
UniProt: Q9ESS2
Position
10; 10 C1
AA seq 162 aa
MRSRLWLGLAWLLLARAPGAPGGYPHLEGDVRWRRLFSSTHFFLRVDLGGRVQGTRWRHG
QDSIVEIRSVRVGTVVIKAVYSGFYVAMNRRGRLYGSRVYSVDCRFRERIEENGYNTYAS
RRWRHRGRPMFLALDSQGIPRQGRRTRRHQLSTHFLPVLVSS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcgcagccgcctctggctgggcctagcctggctgctgttggcgcgggcaccgggcgct
ccgggagggtacccgcatctggagggcgacgtgcgctggcgccgcctcttctcctccact
cactttttcctgcgtgtggaccttggtggtcgggtgcaggggacgcgttggcggcacggc
caggacagtatagtggagatccgttctgtccgtgtgggcactgtggtgatcaaagctgtg
tactcaggcttctatgtggccatgaatcgcaggggccgcctctatgggtcgcgggtctac
tctgtggactgtaggttccgggagcgcatcgaggagaacggctacaacacatacgcctcg
cgacgttggaggcaccgcggccgacccatgttcctggcacttgacagccaaggcattccc
aggcaaggcagacggacacgacggcaccaactgtccacacacttcctgccagtcttggtc
tcgtcttga

KEGG   Mus musculus (mouse): 80857
Entry
80857             CDS       T01002                                 

Gene name
Fgf20, Fgf4a
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    80857 (Fgf20)
   04014 Ras signaling pathway
    80857 (Fgf20)
   04015 Rap1 signaling pathway
    80857 (Fgf20)
   04020 Calcium signaling pathway
    80857 (Fgf20)
   04151 PI3K-Akt signaling pathway
    80857 (Fgf20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    80857 (Fgf20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    80857 (Fgf20)
  09162 Cancer: specific types
   05226 Gastric cancer
    80857 (Fgf20)
   05218 Melanoma
    80857 (Fgf20)
   05224 Breast cancer
    80857 (Fgf20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    80857 (Fgf20)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    80857 (Fgf20)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   80857 (Fgf20)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   80857 (Fgf20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 80857
NCBI-ProteinID: NP_085113
MGI: 1891346
Ensembl: ENSMUSG00000031603
Vega: OTTMUSG00000031718
UniProt: Q9ESL9
Position
8; 8 A4
AA seq 211 aa
MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHL
HGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcccttgaccgaagtcggggctttcttgggcggcctggagggcttgagccagcag
gtggggtcgcacttcttgctgcctcctgcaggggagaggccaccgctgttaggggagcgg
cggggcgcgttggagaggggcgcccgcggcgggcccggttccgtggagctggcgcacctg
cacggcatcctgcgccgccggcagctctactgccgcaccggcttccacctgcagatcctg
cccgacggcaccgtgcagggcacccggcaggatcacagtctcttcggtatcctggaattc
atcagtgtggcagtgggactggtcagtatcagaggtgtggacagtggcctgtaccttggg
atgaatgacaaaggagaactttatggatcagagaaattgacttctgaatgcatcttcagg
gaacaatttgaagagaactggtataatacctattcgtccaacatatataaacatggagac
acgggtcgcaggtattttgtagcacttaacaaggatggaactccaagagatggtgccagg
tccaaaagacatcaaaagtttacccactttttaccaagaccagtagacccagaaagagtt
ccagaattatacaaagacctactgatgtacacttga

KEGG   Mus musculus (mouse): 80903
Entry
80903             CDS       T01002                                 

Gene name
Fgf16, Fgf4c
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    80903 (Fgf16)
   04014 Ras signaling pathway
    80903 (Fgf16)
   04015 Rap1 signaling pathway
    80903 (Fgf16)
   04020 Calcium signaling pathway
    80903 (Fgf16)
   04151 PI3K-Akt signaling pathway
    80903 (Fgf16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    80903 (Fgf16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    80903 (Fgf16)
  09162 Cancer: specific types
   05226 Gastric cancer
    80903 (Fgf16)
   05218 Melanoma
    80903 (Fgf16)
   05224 Breast cancer
    80903 (Fgf16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    80903 (Fgf16)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    80903 (Fgf16)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   80903 (Fgf16)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   80903 (Fgf16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 80903
NCBI-ProteinID: NP_085117
MGI: 1931627
Ensembl: ENSMUSG00000031230
Vega: OTTMUSG00000018263
UniProt: Q9ESL8
Position
X; X D
AA seq 207 aa
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFRYR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcggaggtcgggggcgtctttgcctccttggactgggacctgcacggcttctcctcc
tctctggggaacgtgcccttagctgactccccgggtttcctgaacgagcgcctgggccag
atcgaggggaagctgcagcgcggctcgcccacagacttcgcccacctgaaggggatcctg
cggcgccgccagctctactgccgcaccggcttccaccttgagatcttccccaacggcacg
gtgcacggcacccgccacgaccacagccgcttcggaattctggaatttatcagcttggct
gtggggctgatcagcatcaggggagtggactctggcctgtacctaggaatgaatgagcga
ggagagctctatggatcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa
gaaaactggtacaacacctatgcctccaccttgtacaaacactcggactcggagagacag
tattatgtggccctgaataaagacggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttaccaaggccagtagatccttctaagttgccctccatgtcc
agagatctcttccgctataggtaa

DBGET integrated database retrieval system