KEGG   Mus musculus (mouse): 14170
Entry
14170             CDS       T01002                                 

Symbol
Fgf15, FGF19, Fgf8a
Name
(RefSeq) fibroblast growth factor 15
  KO
K22603  fibroblast growth factor 19
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14170 (Fgf15)
   04014 Ras signaling pathway
    14170 (Fgf15)
   04015 Rap1 signaling pathway
    14170 (Fgf15)
   04020 Calcium signaling pathway
    14170 (Fgf15)
   04151 PI3K-Akt signaling pathway
    14170 (Fgf15)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14170 (Fgf15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14170 (Fgf15)
  09162 Cancer: specific types
   05226 Gastric cancer
    14170 (Fgf15)
   05218 Melanoma
    14170 (Fgf15)
   05224 Breast cancer
    14170 (Fgf15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14170 (Fgf15)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14170 (Fgf15)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14170 (Fgf15)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14170 (Fgf15)
SSDB
Motif
Pfam: FGF Fascin DUF3458
Other DBs
NCBI-GeneID: 14170
NCBI-ProteinID: NP_032029
MGI: 1096383
Ensembl: ENSMUSG00000031073
Vega: OTTMUSG00000059889
UniProt: O35622 Q790L8
Position
7:144450269..144454690
AA seq 218 aa
MARKWNGRAVARALVLATLWLAVSGRPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGP
YVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLI
RYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFET
GDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcgagaaagtggaacgggcgtgcggtggcccgagccctggtcctggccactctgtgg
ctggctgtgtctgggcgtcccctggctcagcaatcccagtctgtgtcagatgaagatcca
ctctttctctacggctggggcaagattacccgcctgcagtacctgtactccgctggtccc
tatgtctccaactgcttcctccgaatccggagcgacggctctgtggactgcgaggaggac
caaaacgaacgaaatttgttggaattccgcgcggtcgctctgaagacgattgccatcaag
gacgtcagcagcgtgcggtacctctgcatgagcgcggacggcaagatatacgggctgatt
cgctactcggaggaagactgtaccttcagggaggaaatggactgtttaggctacaaccag
tacagatccatgaagcaccatctccatatcatcttcatccaggccaagcccagagaacag
ctccaggaccagaaaccctcaaactttatccccgtgtttcaccgctccttctttgaaacc
ggggaccagctgaggtctaaaatgttctccctgcccctggagagtgacagcatggatccg
ttcaggatggtggaggatgtagaccacctagtgaagagtcccagcttccagaaatga

DBGET integrated database retrieval system