KEGG   Mus musculus (mouse): 14173
Entry
14173             CDS       T01002                                 

Gene name
Fgf2, Fgf-2, Fgf2a, Fgfb, bFGF
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14173 (Fgf2)
   04014 Ras signaling pathway
    14173 (Fgf2)
   04015 Rap1 signaling pathway
    14173 (Fgf2)
   04020 Calcium signaling pathway
    14173 (Fgf2)
   04151 PI3K-Akt signaling pathway
    14173 (Fgf2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14173 (Fgf2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14173 (Fgf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14173 (Fgf2)
   05205 Proteoglycans in cancer
    14173 (Fgf2)
  09162 Cancer: specific types
   05226 Gastric cancer
    14173 (Fgf2)
   05218 Melanoma
    14173 (Fgf2)
   05224 Breast cancer
    14173 (Fgf2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    14173 (Fgf2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14173 (Fgf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14173 (Fgf2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14173 (Fgf2)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14173 (Fgf2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14173 (Fgf2)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 14173
NCBI-ProteinID: NP_032032
MGI: 95516
Ensembl: ENSMUSG00000037225
Vega: OTTMUSG00000007393
UniProt: P15655 Q541T2
Position
3 B; 3 18.41 cM
AA seq 154 aa
MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVK
LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYS
SWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 465 nt   +upstreamnt  +downstreamnt
atggctgccagcggcatcacctcgcttcccgcactgccggaggacggcggcgccgccttc
ccaccaggccacttcaaggaccccaagcggctctactgcaagaacggcggcttcttcctg
cgcatccatcccgacggccgcgtggatggcgtccgcgagaagagcgacccacacgtcaaa
ctacaactccaagcagaagagagaggagttgtgtctatcaagggagtgtgtgccaaccgg
taccttgctatgaaggaagatggacggctgctggcttctaagtgtgttacagaagagtgt
ttcttctttgaacgactggaatctaataactacaatacttaccggtcacggaaatactcc
agttggtatgtggcactgaaacgaactgggcagtataaactcggatccaaaacgggacct
ggacagaaggccatactgtttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system