KEGG   Mus musculus (mouse): 14175Help
Entry
14175             CDS       T01002                                 

Gene name
Fgf4, Fgf-4, Fgfk, HBGF-4, Hst1, Hstf-1, KS3, hst, hst-1, kFGF
Definition
(RefSeq) fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14175 (Fgf4)
   04015 Rap1 signaling pathway
    14175 (Fgf4)
   04010 MAPK signaling pathway
    14175 (Fgf4)
   04151 PI3K-Akt signaling pathway
    14175 (Fgf4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14175 (Fgf4)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    14175 (Fgf4)
  09162 Cancers: Specific types
   05226 Gastric cancer
    14175 (Fgf4)
   05218 Melanoma
    14175 (Fgf4)
   05224 Breast cancer
    14175 (Fgf4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14175 (Fgf4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14175 (Fgf4)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14175 (Fgf4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   14175 (Fgf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 14175
NCBI-ProteinID: NP_034332
MGI: 95518
Ensembl: ENSMUSG00000050917
Vega: OTTMUSG00000059887
UniProt: P11403
Position
7 F5; 7 88.88 cM
AA seq 202 aa AA seqDB search
MAKRGPTTGTLLPRVLLALVVALADRGTAAPNGTRHAELGHGWDGLVARSLARLPVAAQP
PQAAVRSGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRG
VVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKN
GRTKKGNRVSPTMKVTHFLPRL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacgcgggccgaccacagggacgctgctgcccagggtcctgctggccctggtg
gtggccctggcggaccgagggaccgccgcacccaacggcacgcggcacgcagaattgggg
cacggctgggacggcttggtggcccgctcgctggcacgcctgccggtggccgcgcagccc
ccgcaggcggcggtccgcagcggcgcaggggactacctgctgggcctcaaaaggcttcgg
cggctctactgcaacgtgggcatcggattccacctgcaggtgctgcccgacggccgcatc
ggtggtgtgcacgcagacacgagggacagtcttctggagctctctccggtgcagcgaggc
gtggtgagcatcttcggagtggccagccggttcttcgtggccatgagcagcaggggcaag
ctcttcggtgtgcctttctttaccgacgagtgtaaattcaaagaaatacttctgcccaac
aactacaacgcctacgaatcctacgcgtaccccggtatgttcatggccctcagtaagaac
gggcggaccaagaaggggaaccgagtgtcgcctaccatgaaggtaacccacttccttcct
agactgtga

DBGET integrated database retrieval system