KEGG   Mus musculus (mouse): 14181Help
Entry
14181             CDS       T01002                                 

Gene name
Fgfbp1, FGF-BP, FGF-BP1, FGFBP-1
Definition
(RefSeq) fibroblast growth factor binding protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FGF-BP1
Motif
Other DBs
NCBI-GeneID: 14181
NCBI-ProteinID: NP_001258545
MGI: 1096350
Ensembl: ENSMUSG00000048373
Vega: OTTMUSG00000029016
UniProt: O70514
Position
5; 5 B3
AA seq 251 aa AA seqDB search
MRLHSLILLSFLLLATQAFSEKVRKRAKNAPHSTAEEGVEGSAPSLGKAQNKQRSRTSKS
LTHGKFVTKDQATCRWAVTEEEQGISLKVQCTQADQEFSCVFAGDPTDCLKHDKDQIYWK
QVARTLRKQKNICRNAKSVLKTRVCRKRFPESNLKLVNPNARGNTKPRKEKAEVSAREHN
KVQEAVSTEPNRVKEDITLNPAATQTMAIRDPECLEDPDVLNQRKTALEFCGESWSSICT
FFLNMLQATSC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagactccacagcctcatcctgctctccttccttctcctggctactcaggcgttctca
gaaaaggtcagaaagagagccaagaacgcaccacacagcacagcggaggagggggtagag
ggttcagctccctcgttagggaaggcccagaataagcagagaagcaggacatctaaatct
ctgacgcatggcaagtttgtcaccaaagaccaagccacatgcagatgggctgtgactgag
gaggagcagggcatcagcctgaaggtccagtgcacacaagccgatcaggagttttcttgt
gtttttgctggtgacccaactgactgccttaaacacgacaaagaccagatctactggaaa
caggttgcccgcacgctgcgcaaacagaaaaatatctgcaggaacgccaagagtgtcttg
aagaccagagtgtgcagaaagagatttccagagtctaacctcaagctggtgaaccccaac
gcacgtggaaacacgaagcccaggaaggagaaagcagaggtctccgcaagggagcacaac
aaggtccaagaagctgtctccacggagccaaacagggtcaaagaagacatcacactcaat
ccagctgcgacccagaccatggccattagagatccagagtgtctagaggatccagatgtg
ctcaaccagaggaagaccgccctggagttctgtggggaatcttggagctccatttgcaca
ttcttcctcaacatgttacaggcgacatcatgctaa

DBGET integrated database retrieval system