KEGG   Mus musculus (mouse): 14184Help
Entry
14184             CDS       T01002                                 

Gene name
Fgfr3, CD333, FR3, Fgfr-3, Flg-2, HBGFR, Mfr3, sam3
Definition
(RefSeq) fibroblast growth factor receptor 3
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05219  Bladder cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14184 (Fgfr3)
   04015 Rap1 signaling pathway
    14184 (Fgfr3)
   04010 MAPK signaling pathway
    14184 (Fgfr3)
   04151 PI3K-Akt signaling pathway
    14184 (Fgfr3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14184 (Fgfr3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14184 (Fgfr3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14184 (Fgfr3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14184 (Fgfr3)
   05206 MicroRNAs in cancer
    14184 (Fgfr3)
   05230 Central carbon metabolism in cancer
    14184 (Fgfr3)
  09162 Cancer: specific types
   05219 Bladder cancer
    14184 (Fgfr3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14184 (Fgfr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14184 (Fgfr3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14184 (Fgfr3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14184 (Fgfr3)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14184 (Fgfr3)
CD molecules [BR:mmu04090]
 Proteins
  14184 (Fgfr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM C2-set_2 Kinase-like Pkinase_fungal DUF1533 RIO1
Motif
Other DBs
NCBI-GeneID: 14184
NCBI-ProteinID: NP_001156687
MGI: 95524
Ensembl: ENSMUSG00000054252
Vega: OTTMUSG00000021524
UniProt: Q7TSI8
Position
5 B2; 5 17.83 cM
AA seq 800 aa AA seqDB search
MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCH
PPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFS
VRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSI
SWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVL
ERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYV
TVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMET
DEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHKVSRFPLKRQVSLE
SNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGCFGQV
VMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACT
QGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQVARGME
YLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEAL
FDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPASCTHDLYMI
MRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDTPSSSSSGDD
SVFTHDLLPPGPPSNGGPRT
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcccggcctgcgtgctagtgttctgcgtggcggtcgtggctggagctacttcc
gagcctcctggtccagagcagcgagttgtgcggagagcggcagaggttccagggcctgaa
cctagccagcaggagcaggtggccttcggcagtggggacaccgtggagctgagctgccat
cctcctggaggtgcccccacagggcccacggtctgggctaaggatggtacaggtctggtg
gcctcccaccgcatcctggtggggcctcagaggctgcaagtgctaaatgcctcccacgaa
gatgcaggggtctacagctgccagcaccggctcactcggcgtgtgctgtgccacttcagt
gtgcgtgtaacagatgctccatcctcaggagatgacgaagatggggaggacgtggctgaa
gacacaggggctccttattggactcgcccggagcgaatggataagaaactgctggctgtg
ccagccgcaaacactgtccgcttccgctgcccagctgctggcaaccctaccccctccatc
tcctggctgaagaatggcaaagaattccgaggggagcatcgcattgggggcatcaagctc
cggcaccagcagtggagcttggtcatggaaagtgtggtaccctccgatcgtggcaactat
acctgtgtagttgagaacaagtttggcagcatccggcagacatacacactggatgtgctg
gagcgctccccacaccggcccatcctgcaggctgggctgccggccaaccagacagccatt
ctaggcagtgacgtggagttccactgcaaggtgtacagcgatgcacagccacacatccag
tggctgaagcacgtggaagtgaacggcagcaaggtgggccctgacggcacgccctacgtc
actgtactcaagactgcaggcgctaacaccaccgacaaggagctagaggttctgtccttg
cacaatgtcacctttgaggacgcgggggagtacacctgcctggcgggcaattctattggg
ttttcccatcactctgcgtggctggtggtgctgccagctgaggaggagctgatggaaact
gatgaggctggcagcgtgtacgcaggcgtcctcagctacggggtggtcttcttcctcttc
atcctggtggtggcagctgtgatactctgccgcctgcgcagtcccccaaagaagggcttg
ggctcgcccaccgtgcacaaggtctctcgcttcccgcttaagcgacaggtgtccttggaa
tctaactcctctatgaactccaacacaccccttgtccggattgcccggctgtcctcagga
gaaggtcctgttctggccaatgtttctgaacttgagctgcctgctgaccccaagtgggag
ctatccaggacccggctgacacttggtaagcctcttggagaaggctgctttggacaggtg
gtcatggcagaagctattggcatcgacaaggaccgtactgccaagcctgtcaccgtggcc
gtgaagatgctgaaagatgatgcgactgacaaggacctgtcggacctggtatctgagatg
gagatgatgaaaatgattggcaagcacaagaacatcattaacctgctgggggcgtgcaca
cagggtgggcccctgtatgtgctggtggagtacgcagccaagggcaatctccgggagttc
cttcgggcgcggcggcctccaggcatggactactcctttgatgcctgcaggctgccagag
gaacagctcacctgcaaggatctagtgtcctgtgcctaccaggtggcacggggcatggaa
tacttggcttctcagaagtgtattcacagagacttggctgccagaaacgtcctggtgacc
gaggacaatgtgatgaagattgcggactttggcctggctcgagatgtgcacaacctggac
tactacaagaagaccacaaatggccggctacctgtgaagtggatggcaccagaggccctt
tttgaccgagtctacacccaccagagtgatgtttggtcttttggtgtcctcctctgggag
atctttacgctggggggctcaccgtatcctggcatcccagtggaagagcttttcaagctg
ttgaaagagggccaccgcatggacaagccagccagctgcacacatgacctgtacatgatc
atgcgggaatgttggcatgcggtgccttcacagaggcccaccttcaagcagttggtagag
gatttagaccgcatcctcactgtgacatcaaccgacgagtacttggacctctccgtgccg
tttgagcagtactcgccaggtggccaggacacgcctagctccagctcgtccggagatgac
tcggtgttcacccatgacctgctacccccaggtccacccagtaacgggggacctcggacg
tga

DBGET integrated database retrieval system