KEGG   Mus musculus (mouse): 14186Help
Entry
14186             CDS       T01002                                 

Gene name
Fgfr4, Fgfr-4
Definition
(RefSeq) fibroblast growth factor receptor 4
  KO
K05095  fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14186 (Fgfr4)
   04015 Rap1 signaling pathway
    14186 (Fgfr4)
   04010 MAPK signaling pathway
    14186 (Fgfr4)
   04151 PI3K-Akt signaling pathway
    14186 (Fgfr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14186 (Fgfr4)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14186 (Fgfr4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14186 (Fgfr4)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    14186 (Fgfr4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14186 (Fgfr4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14186 (Fgfr4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14186 (Fgfr4)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14186 (Fgfr4)
CD molecules [BR:mmu04090]
 Proteins
  14186 (Fgfr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 I-set Ig_2 ig V-set Ig_5 Kinase-like C2-set_2
Motif
Other DBs
NCBI-GeneID: 14186
NCBI-ProteinID: NP_032037
MGI: 95525
Ensembl: ENSMUSG00000005320
Vega: OTTMUSG00000035043
UniProt: Q03142 A0A0R4IZY3
Position
13 B1; 13 29.8 cM
AA seq 799 aa AA seqDB search
MWLLLALLSIFQGTPALSLEASEEMEQEPCLAPILEQQEQVLTVALGQPVRLCCGRTERG
RHWYKEGSRLASAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMTVVHNLTLLMDDSLTS
ISNDEDPKTLSSSSSGHVYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPMPTIH
WLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENSLGSIRYSYLLDVLE
RSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHVVINGSSFGADGFPYVQ
VLKTTDINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDLTWTTATP
EARYTDIILYVSGSLVLLVLLLLAGVYHRQVIRGHYSRQPVTIQKLSRFPLARQFSLESR
SSGKSSLSLVRGVRLSSSGPPLLTGLVNLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVR
AEAFGMDPSRPDQTSTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQE
GPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYL
ESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFD
RVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLMR
ECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPFSPSNGDASSTCSSSDSVFS
HDPLPLEPSPFPFSDSQTT
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgctcttggccctgttgagcatctttcaggggacaccagctttgtcccttgag
gcctctgaggaaatggagcaggagccctgcctagccccaatcctggagcagcaagagcag
gtgttgacggtggccctggggcagcctgtgaggctgtgctgtgggcgcaccgagcgtggt
cgtcactggtacaaagagggcagccgcctagcatctgctgggcgagtacggggttggaga
ggccgcctggagatcgccagcttccttcctgaggatgctggccgatacctctgcctggcc
cgtggctccatgaccgtcgtacacaatcttacgttgcttatggatgactccttaacctcc
atcagtaatgatgaagaccccaagacactcagcagctcctcgagtggtcatgtctaccca
cagcaagcaccctactggacacacccccaacgcatggagaagaaactgcatgcagtgcct
gccgggaatactgtcaaattccgctgtccagctgcagggaaccccatgcctaccatccac
tggctcaaggatggacaggccttccacggggagaatcgtattggaggcattcggctgcgc
caccaacactggagcctggtgatggaaagtgtggtaccctcggaccgtggcacatacaca
tgccttgtggagaactctctgggtagcattcgctacagctatctcctggatgtgctggag
cggtccccgcaccggcccatcctgcaggcggggctcccagccaacaccacagctgtggtt
ggcagcgatgtggagctactctgcaaggtgtacagcgacgcccagccccacatacagtgg
ctgaaacacgtcgtcatcaacggcagcagcttcggcgccgacggtttcccctacgtacaa
gtcctgaagacaacagacatcaatagctcggaggtagaggtcttgtatctgaggaacgtg
tccgctgaggatgcaggagagtatacctgtctggcgggcaactccatcggcctttcctac
cagtcagcgtggctcacggtgctgccagaggaagacctcacgtggacaacagcaacccct
gaggccagatacacagatatcatcctgtatgtatcaggctcactggttctgcttgtgctc
ctgctgctggccggggtgtatcatcggcaagtcatccgtggccactactctcgccagcct
gtcactatacaaaagctgtcccgtttccctttggcccgacagttctctttggagtcgagg
tcctctggcaagtcaagtttgtccctggtgcgaggtgtccgtctctcctccagcggcccg
cccttgctcacgggccttgtgaatctagacctgcctctcgatccgctttgggaattcccc
cgggacaggttggtgctcggaaagcccctgggtgagggctgctttgggcaagtggttcgt
gcagaggcctttggtatggatccctcccggcccgaccaaaccagcaccgtggctgtgaag
atgctgaaagacaatgcctccgacaaggatttggcagacctggtctccgagatggaggtg
atgaagctaatcggaagacacaagaacatcatcaacctgctgggtgtctgcactcaggaa
gggcccctgtacgtgattgtggaatgtgccgccaagggaaaccttcgggaattcctccgt
gcccggcgccccccaggccctgatctcagccctgatggacctcggagcagcgaaggacca
ctctccttcccggccctagtctcctgtgcctaccaggtggcccgaggcatgcagtatctg
gagtctcggaagtgcatccaccgggacctggctgcccgaaatgtgctggtgaccgaggat
gatgtgatgaagatcgctgactttgggctggcacgtggtgtccaccacattgactactat
aagaaaaccagcaacggccgcctgccagtcaaatggatggctccagaggcattgttcgac
cgcgtgtacacacaccagagtgacgtgtggtctttcgggatcctgctgtgggaaatcttc
accctcgggggctccccataccctggcattccggtggaggagctcttctcactgctgcga
gaggggcacaggatggagcggcccccaaactgcccctcagagctgtatgggctaatgagg
gagtgctggcacgcagccccatctcagaggcctacttttaagcagctggtggaagctctg
gacaaggtcctgctggctgtctctgaagagtaccttgacctccgcctgacctttggaccc
ttttctccctccaatggggatgccagcagcacctgctcctccagtgactcggttttcagc
cacgaccctttgcccctcgagccaagccccttccctttctctgactcgcagacgacatga

DBGET integrated database retrieval system