KEGG   Mus musculus (mouse): 14198
Entry
14198             CDS       T01002                                 

Gene name
Fhit, AW045638, Fra1, Fra14A2
Definition
(RefSeq) fragile histidine triad gene
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    14198 (Fhit)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    14198 (Fhit)
   05223 Non-small cell lung cancer
    14198 (Fhit)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     14198 (Fhit)
SSDB
Motif
Pfam: HIT DcpS_C CwfJ_C_1 LPD29
Other DBs
NCBI-GeneID: 14198
NCBI-ProteinID: NP_001295215
MGI: 1277947
Ensembl: ENSMUSG00000060579
Vega: OTTMUSG00000034621
UniProt: O89106
Position
14 A1; 14 5.61 cM
AA seq 150 aa
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQ
VTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKH
DREEEDSPAFWRSEKEMAAEAEALRVYFQA
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtcatttagatttggccaacatctcatcaagccctctgtggtttttctcaaaactgaa
ctgtccttcgccctggtgaataggaaacccgttgtacctggccatgtcctcgtgtgcccg
ctgaggccagtagagcgcttccgtgacctacatcctgatgaagtggccgatttgtttcaa
gtgacccagagagttgggacagtggtggagaagcatttccaggggacctccatcaccttc
tccatgcaagatggtcctgaagctgggcagactgtgaagcatgtacatgtccacgttctt
cccaggaaggcaggggacttcccccggaatgacaacatctatgatgagctccagaaacat
gacagagaagaagaggactcgccagccttttggagatctgagaaggagatggctgcagag
gcggaggctctgcgggtctactttcaggcctga

DBGET integrated database retrieval system