KEGG   Mus musculus (mouse): 14199
Entry
14199             CDS       T01002                                 

Gene name
Fhl1, FHL-1, Kyo, KyoT, RAM14-1, SLIM, SLIM-1
Definition
(RefSeq) four and a half LIM domains 1
  KO
K14365  four and a half LIM domains protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    14199 (Fhl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    14199 (Fhl1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 LIM domain-containing proteins
  FHL family proteins
   14199 (Fhl1)
SSDB
Motif
Pfam: LIM Ureidogly_lyase
Other DBs
NCBI-GeneID: 14199
NCBI-ProteinID: NP_001274729
MGI: 1298387
Ensembl: ENSMUSG00000023092
Vega: OTTMUSG00000017580
UniProt: P97447
Position
X; X A6
AA seq 280 aa
MSEKFDCHYCRDPLQGKKYVQKDGRHCCLKCFDKFCANTCVDCRKPISADAKEVHYKNRY
WHDNCFRCAKCLHPLASETFVSKDGKILCNKCATREDSPRCKGCFKAIVAGDQNVEYKGT
VWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQP
WHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAY
EGQSWHDYCFHCKKCSVNLANKRFVFHNEQVYCPDCAKKL
NT seq 843 nt   +upstreamnt  +downstreamnt
atgtcggagaagttcgactgtcactactgcagggaccccttgcaggggaagaagtacgtg
cagaaggatggccgtcactgctgcctgaagtgctttgacaagttctgcgccaacacctgc
gtggactgccgcaagcccataagcgctgatgccaaggaggtgcattataagaatcgctac
tggcacgacaactgcttccgctgtgccaagtgccttcaccccttggccagtgagaccttt
gtgtccaaggatggcaagatcctgtgcaacaagtgcgctactcgggaggactcccccagg
tgcaaagggtgcttcaaggccattgtggcaggagaccagaacgtggagtacaagggcacc
gtctggcataaagactgcttcacctgcagcaactgcaagcaagtcattgggaccggaagc
ttcttcccgaaaggggaggacttctactgtgtgacttgccatgagaccaagttcgccaaa
cattgcgtgaagtgcaacaaggccatcacatctggaggaatcacttaccaggatcagccc
tggcatgccgagtgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttc
accgctgtggaggaccagtattactgcgtggattgctacaagaactttgtggccaagaag
tgtgctggatgcaagaaccccatcactgggtttggtaaaggctccagtgtggtggcctat
gaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccgtgaatctggcc
aacaagcgctttgtatttcataatgagcaggtgtattgccctgactgtgccaaaaagctg
taa

DBGET integrated database retrieval system