KEGG   Mus musculus (mouse): 14200
Entry
14200             CDS       T01002                                 

Gene name
Fhl2, FHL-2, SL, SLIM-3, SLIM3
Definition
(RefSeq) four and a half LIM domains 2
  KO
K14380  four and a half LIM domains protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14200 (Fhl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    14200 (Fhl2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 LIM domain-containing proteins
  FHL family proteins
   14200 (Fhl2)
SSDB
Motif
Pfam: LIM zf-ribbon_3 DUF2685
Other DBs
NCBI-GeneID: 14200
NCBI-ProteinID: NP_001276462
MGI: 1338762
Ensembl: ENSMUSG00000008136
Vega: OTTMUSG00000046311
UniProt: O70433 Q543D7
Position
1; 1 C1.1
AA seq 279 aa
MTERFDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRH
WHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGS
SWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYREQP
WHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFE
ERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
NT seq 840 nt   +upstreamnt  +downstreamnt
atgactgaacgctttgactgccaccactgcaatgaatctctgtacggcaagaagtacatt
ctaaaggaggagaacccacactgtgtggcctgctttgaggaactctatgccaatacctgt
gaggagtgtggaacacccatcggctgcgactgcaaggacttgtcctacaaggatcggcac
tggcatgaaggctgcttccattgctcccggtgtggaagctcgctggtggacaagcccttt
gctgccaaggaggaacagctgctgtgcaccgactgctattccaatgaatactcgtccaag
tgccaggaatgcaagaaaaccatcatgccaggtacccgcaagatggaatacaagggcagc
agctggcacgagacctgcttcacctgtcagcgctgccagcagcccattggaaccaagagc
ttcatacctaaggagaatcagaacttctgcgtgccctgctatgagaagcagtatgccctg
cagtgcgtgcagtgcaaaaagcctatcaccacaggaggtgttacttaccgggagcagccc
tggcacaaggaatgctttgtgtgcacagcctgcaagaagcagctatctgggcaacgcttc
acagcacgggatgagtttccatactgcctgacctgcttctgtgacttgtacgctaagaaa
tgtgctgggtgcaccaaccccattagtggtctgggtggcacaaagtacatctctttcgag
gaacgccaatggcacaacgactgctttaactgtaagaagtgctccctgtctctggtggga
cgaggcttcctcacagagagagatgacatcctctgtcctgactgtggaaaggatatttga

DBGET integrated database retrieval system